BLASTX nr result
ID: Alisma22_contig00030342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00030342 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU49763.1 hypothetical protein TSUD_386820 [Trifolium subterran... 53 1e-06 XP_003593550.1 polyol/monosaccharide transporter 1 [Medicago tru... 55 3e-06 XP_020115093.1 probable polyol transporter 4 [Ananas comosus] 54 6e-06 >GAU49763.1 hypothetical protein TSUD_386820 [Trifolium subterraneum] Length = 73 Score = 52.8 bits (125), Expect = 1e-06 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 3/75 (4%) Frame = -2 Query: 217 MVGLEGAGAGMQPL--ELPTSGKGRY-RRVTDLAWAEEEVGTSVRNGSWLRERDPRRYVY 47 ++G++ G G L E+P K +Y R ++D + E+E+G S + D ++Y++ Sbjct: 3 LIGIQENGNGNGDLVSEIPLGTKTKYIRMISDDSTEEQELGFSTN------KHDAKKYIF 56 Query: 46 ACAVFASLNSILLGY 2 ACA+FASLNS+LLGY Sbjct: 57 ACAIFASLNSVLLGY 71 >XP_003593550.1 polyol/monosaccharide transporter 1 [Medicago truncatula] AES63801.1 polyol/monosaccharide transporter 1 [Medicago truncatula] Length = 523 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = -2 Query: 178 LELPTSGKGRYRRVTDLAWAEEEVGTSVRNGSWLRERDPRRYVYACAVFASLNSILLGY 2 +E+P K +Y R+T EEE G + R + D ++Y++ACAVFASLNS+LLGY Sbjct: 17 IEIPLGAKNKYIRMTSEEEEEEEEGFATR------KHDSKKYIFACAVFASLNSVLLGY 69 >XP_020115093.1 probable polyol transporter 4 [Ananas comosus] Length = 536 Score = 54.3 bits (129), Expect = 6e-06 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 5/58 (8%) Frame = -2 Query: 160 GKGRYRRV-TDLAWAEEEV----GTSVRNGSWLRERDPRRYVYACAVFASLNSILLGY 2 GKG+YRR+ +A EEE+ G + +R + RRYV+ACAVFASLNS+LLGY Sbjct: 21 GKGKYRRMDAPIAEEEEEIDEGGGGAGAMAKGMRTSESRRYVFACAVFASLNSVLLGY 78