BLASTX nr result
ID: Alisma22_contig00030255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00030255 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNA13408.1 hypothetical protein SOVF_117290 [Spinacia oleracea] 55 4e-07 AIC35288.1 defensin 4 [Pinus sylvestris] 52 7e-06 >KNA13408.1 hypothetical protein SOVF_117290 [Spinacia oleracea] Length = 74 Score = 54.7 bits (130), Expect = 4e-07 Identities = 25/54 (46%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +3 Query: 201 VQQVEGQ-CVRLGPSGTYKGICGFDDSCKEECNKEGFPRGGRCSRYRCECYKPC 359 V +V+G C + PS +KGICGFD C + C++E +P G YRCEC +PC Sbjct: 23 VVEVDGATCAK--PSKFFKGICGFDRDCVKACSQENWPGGACVPPYRCECRRPC 74 >AIC35288.1 defensin 4 [Pinus sylvestris] Length = 83 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +3 Query: 198 EVQQVEGQCVRLGPSGTYKGICGFDDSCKEECNKEGFPRGG---RCSRYRCECYKPC 359 EVQ EG+ + PSG +KG C +CK C EGFP G + +C CYKPC Sbjct: 27 EVQVAEGRMCKT-PSGKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC 82