BLASTX nr result
ID: Alisma22_contig00030132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00030132 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013893324.1 hypothetical protein MNEG_13657 [Monoraphidium ne... 54 5e-06 >XP_013893324.1 hypothetical protein MNEG_13657 [Monoraphidium neglectum] KIY94304.1 hypothetical protein MNEG_13657 [Monoraphidium neglectum] Length = 271 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/65 (41%), Positives = 32/65 (49%) Frame = -3 Query: 358 QTDGGADLQSRNTTRRAEVPRRYAVSGVPSDTCFRCLQRGH*QARCSSPRVCFRCRLPGH 179 Q DGG + + YAV V CF C + GH QA C PR CF+C PGH Sbjct: 26 QADGGGGGGADKEEEEFDGGEEYAVQAVQ---CFNCKRLGHRQADCPMPRRCFQCNQPGH 82 Query: 178 RASAC 164 RA+ C Sbjct: 83 RAAQC 87