BLASTX nr result
ID: Alisma22_contig00029913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00029913 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT58726.1 Pentatricopeptide repeat-containing protein At2g26790... 60 1e-08 >JAT58726.1 Pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Anthurium amnicola] Length = 835 Score = 60.1 bits (144), Expect = 1e-08 Identities = 34/80 (42%), Positives = 46/80 (57%) Frame = +3 Query: 6 ILCHARLEKKLITLFCDLIRVNHGSMSEILAVFTILSEVPGEGTAVPVLYSALSSLIKAY 185 ILC LEK+L+TLF D+I N S ++L++F LSE V A ++IKAY Sbjct: 118 ILCRPGLEKELMTLFSDMISSNEDSSFDVLSLFDALSE---GSNVVHAGVRAFDAVIKAY 174 Query: 186 AELQMPEEAAYAFSELGNHG 245 A L+MP+ A Y F +L G Sbjct: 175 AHLKMPDRATYVFFQLCGRG 194