BLASTX nr result
ID: Alisma22_contig00029761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00029761 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEX01258.1 ribosomal protein S7 (plastid) [Alisma triviale] 226 2e-74 AEX01261.1 ribosomal protein S7 (plastid) [Hydrocleys martii] 224 3e-73 Q67IC5.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 219 3e-71 YP_004769856.1 ribosomal protein S7 (chloroplast) [Wolffiella li... 218 4e-71 YP_008592535.1 ribosomal protein S7 (chloroplast) [Andrographis ... 218 7e-71 YP_087012.1 ribosomal protein S7 [Panax ginseng] YP_087025.1 rib... 217 1e-70 Q67IP2.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 217 1e-70 YP_004769673.1 ribosomal protein S7 (chloroplast) [Spirodela pol... 217 1e-70 AKZ24099.1 ribosomal protein S7 (plastid) [Monarda fistulosa var... 217 1e-70 YP_009155340.1 ribosomal protein S7 (plastid) [Seseli montanum] ... 217 1e-70 YP_009162308.1 ribosomal protein S7 (chloroplast) [Scutellaria b... 217 1e-70 YP_003359404.1 ribosomal protein S7 (chloroplast) [Olea europaea... 217 1e-70 AEX01324.1 ribosomal protein S7 (plastid) [Pleea tenuifolia] 217 1e-70 AEX01291.1 ribosomal protein S7 (plastid) [Ruppia maritima] 217 1e-70 YP_009241877.1 ribosomal protein S7 (plastid) [Potamogeton perfo... 217 1e-70 YP_006665826.1 ribosomal protein S7 (chloroplast) [Elodea canade... 217 1e-70 AEX01264.1 ribosomal protein S7 (plastid) [Stratiotes aloides] 217 1e-70 ADK89738.1 ribosomal protein S7 (chloroplast) [Hydrocotyle verti... 217 1e-70 YP_001595553.1 ribosomal protein S7 [Lemna minor] YP_001595568.1... 217 1e-70 YP_009241792.1 ribosomal protein S7 (plastid) [Tofieldia thibeti... 217 1e-70 >AEX01258.1 ribosomal protein S7 (plastid) [Alisma triviale] Length = 155 Score = 226 bits (577), Expect = 2e-74 Identities = 117/117 (100%), Positives = 117/117 (100%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR Sbjct: 99 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 155 >AEX01261.1 ribosomal protein S7 (plastid) [Hydrocleys martii] Length = 155 Score = 224 bits (570), Expect = 3e-73 Identities = 116/117 (99%), Positives = 116/117 (99%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 155 >Q67IC5.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAN32069.1 ribosomal protein S7 (chloroplast) [Xeronema callistemon] AAN32078.1 ribosomal protein S7 (chloroplast) [Asparagus officinalis] AEX94151.1 ribosomal protein S7 (chloroplast) [Asparagus officinalis] AEX94152.1 ribosomal protein S7 (chloroplast) [Asparagus asparagoides] AEX94153.1 ribosomal protein S7 (chloroplast) [Hemiphylacus alatostylus] AEX94183.1 ribosomal protein S7 (chloroplast) [Xeronema callistemon] AFG25680.1 ribosomal protein S7, partial (plastid) [Asparagus officinalis] Length = 155 Score = 219 bits (557), Expect = 3e-71 Identities = 113/117 (96%), Positives = 115/117 (98%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET +MAEAN AFAHFR Sbjct: 99 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >YP_004769856.1 ribosomal protein S7 (chloroplast) [Wolffiella lingulata] YP_004769871.1 ribosomal protein S7 (chloroplast) [Wolffiella lingulata] YP_004769991.1 ribosomal protein S7 (chloroplast) [Wolffia australiana] YP_004770006.1 ribosomal protein S7 (chloroplast) [Wolffia australiana] AEK94469.1 ribosomal protein S7 (chloroplast) [Wolffiella lingulata] AEK94484.1 ribosomal protein S7 (chloroplast) [Wolffiella lingulata] AEK94552.1 ribosomal protein S7 (chloroplast) [Wolffia australiana] AEK94567.1 ribosomal protein S7 (chloroplast) [Wolffia australiana] Length = 155 Score = 218 bits (556), Expect = 4e-71 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_008592535.1 ribosomal protein S7 (chloroplast) [Andrographis paniculata] YP_008592548.1 ribosomal protein S7 (chloroplast) [Andrographis paniculata] AGT79893.1 ribosomal protein S7 (chloroplast) [Andrographis paniculata] AGT79906.1 ribosomal protein S7 (chloroplast) [Andrographis paniculata] Length = 155 Score = 218 bits (554), Expect = 7e-71 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRA+KKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYRIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_087012.1 ribosomal protein S7 [Panax ginseng] YP_087025.1 ribosomal protein S7 [Panax ginseng] YP_740163.1 ribosomal protein S7 (chloroplast) [Daucus carota] YP_740176.1 ribosomal protein S7 (chloroplast) [Daucus carota] YP_004222692.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] YP_004222705.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] YP_004935599.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] YP_004935612.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] YP_008815077.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] YP_008815090.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] YP_008815164.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] YP_008815177.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] YP_008814903.1 ribosomal protein S7 (chloroplast) [Aralia undulata] YP_008814916.1 ribosomal protein S7 (chloroplast) [Aralia undulata] YP_008815251.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] YP_008815264.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] YP_009121220.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] YP_009121233.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] YP_009122772.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] YP_009122785.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] YP_009155258.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] YP_009155271.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] YP_009155473.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] YP_009155487.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] YP_009159584.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] YP_009159598.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] YP_009161726.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] YP_009161739.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] YP_009186298.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] YP_009186313.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] YP_009191899.1 ribosomal protein S7 (chloroplast) [Panax japonicus] YP_009191913.1 ribosomal protein S7 (chloroplast) [Panax japonicus] YP_009191986.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] YP_009192000.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] YP_009232790.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] YP_009232806.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] YP_009232875.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] YP_009232891.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] YP_009232960.1 ribosomal protein S7 (chloroplast) [Angelica gigas] YP_009232976.1 ribosomal protein S7 (chloroplast) [Angelica gigas] YP_009233044.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] YP_009233060.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] YP_009235925.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] YP_009235939.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] YP_009236010.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] YP_009236023.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] YP_009240841.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] YP_009240854.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] YP_009241112.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] YP_009241098.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] YP_009266564.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] YP_009266578.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] YP_009306821.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] YP_009306834.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] YP_009330735.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] YP_009330748.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] YP_009331749.1 ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] YP_009338302.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] YP_009338315.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] YP_009338386.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] YP_009338400.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] YP_009338469.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] YP_009338482.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] Q68RU7.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q0G9Q3.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAT98555.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AAT98570.1 ribosomal protein S7 (chloroplast) [Panax ginseng] ABI32469.1 ribosomal protein S7 (chloroplast) [Daucus carota] ABI32484.1 ribosomal protein S7 (chloroplast) [Daucus carota] ABU85171.1 ribosomal protein S7, partial (chloroplast) [Anethum graveolens] ADD13684.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ADD13698.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ADD29890.1 ribosomal protein S7 (chloroplast) [Aucuba japonica] ADK89824.1 ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] ADK89838.1 ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] ADK89997.1 ribosomal protein S7 (chloroplast) [Petroselinum crispum] ADK90011.1 ribosomal protein S7 (chloroplast) [Petroselinum crispum] ADM92747.1 ribosomal protein S7, partial (chloroplast) [Davidia involucrata] AEK71711.1 ribosomal protein S7 (plastid) [Aucuba japonica] AEO92665.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] AEO92678.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] AGG39002.1 ribosomal protein S7 (chloroplast) [Aralia undulata] AGG39017.1 ribosomal protein S7 (chloroplast) [Aralia undulata] AGG39176.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] AGG39191.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] AGG39263.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] AGG39278.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] AGG39350.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] AGG39365.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] AGM15028.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15029.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15114.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15115.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15200.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15201.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGW31960.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGW31961.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AHJ81010.1 ribosomal protein S7 (mitochondrion) [Panax ginseng] AIA24374.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AIA24387.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AIU99067.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] AIU99080.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] AIX97934.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX97948.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98019.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98033.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98104.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98118.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98189.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98203.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98274.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98288.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98359.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98373.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98444.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98458.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98529.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98543.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98615.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98629.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99533.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] AJC99547.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] AJC99618.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99632.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99703.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99717.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJK29888.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] AJK29889.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] AJO25247.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] AJO25248.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] AKB99118.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKB99132.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKB99205.1 ribosomal protein S7 (chloroplast) [Panax japonicus] AKB99219.1 ribosomal protein S7 (chloroplast) [Panax japonicus] AKB99292.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKB99306.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKB99379.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKB99393.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKG26647.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKG26660.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKQ20774.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] AKQ20788.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] AKS11000.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] AKS11014.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] AKU70823.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKU70837.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKZ24089.1 ribosomal protein S7 (plastid) [Cicuta maculata] AKZ24090.1 ribosomal protein S7 (plastid) [Conium maculatum] AKZ24091.1 ribosomal protein S7 (plastid) [Zizia aurea] AKZ29807.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] ALN96875.1 ribosomal protein S7 (chloroplast) [Angelica decursiva] ALN96876.1 ribosomal protein S7 (chloroplast) [Angelica decursiva] ALO71652.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ALO71653.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] AMA97862.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] AMA97863.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] AMA97948.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] AMA97949.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] AMA98033.1 ribosomal protein S7 (chloroplast) [Angelica gigas] AMA98034.1 ribosomal protein S7 (chloroplast) [Angelica gigas] AMA98120.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] AMA98121.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] AMD83961.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] AMD83976.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] AMD84046.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] AMD84060.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] AMK46209.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] AMK46222.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] AMR97494.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AMR97508.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] KZM81269.1 ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] KZM81282.1 ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] ANK36397.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ANK36410.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ANK36481.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] ANK36495.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] ANK36564.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ANK36577.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ANK78376.1 ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78390.1 ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78462.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ANK78476.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ANS71815.1 ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] ANS71829.1 ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] ANS71902.1 ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] ANS71916.1 ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] ANS71989.1 ribosomal protein S7 (chloroplast) [Aralia elata] ANS72003.1 ribosomal protein S7 (chloroplast) [Aralia elata] ANS72075.1 ribosomal protein S7 (chloroplast) [Glehnia littoralis] ANS72091.1 ribosomal protein S7 (chloroplast) [Glehnia littoralis] ANS72158.1 ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ANS72174.1 ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] AOQ76964.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] AOQ76966.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] APD79337.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] APD79350.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] APH07318.1 ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET +MAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >Q67IP2.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAN31961.1 ribosomal protein S7 (chloroplast) [Butomus umbellatus] AEK71815.1 ribosomal protein S7 (plastid) [Aristolochia littoralis] AEX01284.1 ribosomal protein S7 (plastid) [Posidonia australis] AEX01286.1 ribosomal protein S7 (plastid) [Amphibolis griffithii] AEX01294.1 ribosomal protein S7 (plastid) [Maundia triglochinoides] AEX01297.1 ribosomal protein S7 (plastid) [Triglochin maritima] AEX01300.1 ribosomal protein S7 (plastid) [Aponogeton distachyos] AEX01306.1 ribosomal protein S7 (plastid) [Orontium aquaticum] AEX94144.1 ribosomal protein S7 (chloroplast) [Gilliesia graminea] APZ83186.1 ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] APZ83199.1 ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_004769673.1 ribosomal protein S7 (chloroplast) [Spirodela polyrhiza] YP_004769688.1 ribosomal protein S7 (chloroplast) [Spirodela polyrhiza] YP_005097919.1 ribosomal protein S7 (chloroplast) [Colocasia esculenta] YP_005097934.1 ribosomal protein S7 (chloroplast) [Colocasia esculenta] YP_009259011.1 ribosomal protein S7 (chloroplast) [Spathiphyllum kochii] YP_009259026.1 ribosomal protein S7 (chloroplast) [Spathiphyllum kochii] Q6KGV8.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ14236.1 ribosomal protein S7 (chloroplast) [Spathiphyllum wallisii] AEK48452.1 ribosomal protein S7 (chloroplast) [Colocasia esculenta] AEK48467.1 ribosomal protein S7 (chloroplast) [Colocasia esculenta] AEK48538.1 ribosomal protein S7 (chloroplast) [Colocasia esculenta] AEK48553.1 ribosomal protein S7 (chloroplast) [Colocasia esculenta] AEK71781.1 ribosomal protein S7 (plastid) [Spathiphyllum sp. M. J. Moore 338] AEK94385.1 ribosomal protein S7 (chloroplast) [Spirodela polyrhiza] AEK94400.1 ribosomal protein S7 (chloroplast) [Spirodela polyrhiza] AEX01312.1 ribosomal protein S7 (plastid) [Arum italicum] AKJ83638.1 ribosomal protein S7 (chloroplast) [Spathiphyllum kochii] AKJ83639.1 ribosomal protein S7 (chloroplast) [Spathiphyllum kochii] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >AKZ24099.1 ribosomal protein S7 (plastid) [Monarda fistulosa var. mollis] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRA+KKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_009155340.1 ribosomal protein S7 (plastid) [Seseli montanum] YP_009155353.1 ribosomal protein S7 (plastid) [Seseli montanum] AIU99149.1 ribosomal protein S7 (plastid) [Seseli montanum] AIU99162.1 ribosomal protein S7 (plastid) [Seseli montanum] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET +MAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >YP_009162308.1 ribosomal protein S7 (chloroplast) [Scutellaria baicalensis] YP_009162321.1 ribosomal protein S7 (chloroplast) [Scutellaria baicalensis] AKJ77173.1 ribosomal protein S7 (chloroplast) [Scutellaria baicalensis] AKJ77174.1 ribosomal protein S7 (chloroplast) [Scutellaria baicalensis] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 115/117 (98%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRA+KKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLLVASRKRPGRNMAFKLSSELVDAA+GSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLVASRKRPGRNMAFKLSSELVDAAQGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_003359404.1 ribosomal protein S7 (chloroplast) [Olea europaea] YP_003359418.1 ribosomal protein S7 (chloroplast) [Olea europaea] YP_004376466.1 ribosomal protein S7 [Olea europaea subsp. europaea] YP_004376480.1 ribosomal protein S7 [Olea europaea subsp. europaea] YP_004563826.1 ribosomal protein S7 [Olea europaea subsp. cuspidata] YP_004563840.1 ribosomal protein S7 [Olea europaea subsp. cuspidata] YP_004564049.1 ribosomal protein S7 [Olea woodiana subsp. woodiana] YP_004564063.1 ribosomal protein S7 [Olea woodiana subsp. woodiana] YP_004564542.1 ribosomal protein S7 [Olea europaea subsp. maroccana] YP_004564556.1 ribosomal protein S7 [Olea europaea subsp. maroccana] YP_004935713.1 ribosomal protein S7 (chloroplast) [Sesamum indicum] YP_004935726.1 ribosomal protein S7 (chloroplast) [Sesamum indicum] YP_004940555.1 rps7 gene product (chloroplast) [Dorcoceras hygrometricum] YP_004940569.1 rps7 gene product (chloroplast) [Dorcoceras hygrometricum] YP_005090419.1 rps7 gene product (mitochondrion) [Dorcoceras hygrometricum] YP_007353961.1 ribosomal protein S7 (chloroplast) [Tectona grandis] YP_007353974.1 ribosomal protein S7 (chloroplast) [Tectona grandis] YP_007507158.1 ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] YP_007507171.1 ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] YP_008815983.1 ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] YP_008815996.1 ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] YP_008992307.1 ribosomal protein S7 (mitochondrion) [Salvia miltiorrhiza] YP_009002300.1 ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] YP_009002304.1 ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] YP_009110647.1 ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] YP_009110661.1 ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] YP_009115942.1 ribosomal protein S7 [Scrophularia takesimensis] YP_009115956.1 ribosomal protein S7 [Scrophularia takesimensis] YP_009117268.1 ribosomal protein S7 (chloroplast) [Premna microphylla] YP_009117281.1 ribosomal protein S7 (chloroplast) [Premna microphylla] YP_009232089.1 ribosomal protein S7 (chloroplast) [Lavandula angustifolia] YP_009232104.1 ribosomal protein S7 (chloroplast) [Lavandula angustifolia] YP_009242110.1 ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] YP_009242124.1 ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] YP_009242198.1 ribosomal protein S7 (chloroplast) [Stenogyne bifida] YP_009242212.1 ribosomal protein S7 (chloroplast) [Stenogyne bifida] YP_009242286.1 ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] YP_009242300.1 ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] YP_009242374.1 ribosomal protein S7 (chloroplast) [Phyllostegia velutina] YP_009242388.1 ribosomal protein S7 (chloroplast) [Phyllostegia velutina] YP_009242462.1 ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] YP_009242476.1 ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] YP_009242550.1 ribosomal protein S7 (chloroplast) [Stachys chamissonis] YP_009242564.1 ribosomal protein S7 (chloroplast) [Stachys chamissonis] YP_009242638.1 ribosomal protein S7 (chloroplast) [Stachys coccinea] YP_009242652.1 ribosomal protein S7 (chloroplast) [Stachys coccinea] YP_009242726.1 ribosomal protein S7 (chloroplast) [Stachys sylvatica] YP_009242740.1 ribosomal protein S7 (chloroplast) [Stachys sylvatica] YP_009242814.1 ribosomal protein S7 (chloroplast) [Stachys byzantina] YP_009242828.1 ribosomal protein S7 (chloroplast) [Stachys byzantina] YP_009254261.1 ribosomal protein S7 (chloroplast) [Erythranthe lutea] YP_009254274.1 ribosomal protein S7 (chloroplast) [Erythranthe lutea] YP_009270959.1 ribosomal protein S7 (chloroplast) [Perilla setoyensis] YP_009270973.1 ribosomal protein S7 (chloroplast) [Perilla setoyensis] YP_009270783.1 ribosomal protein S7 (chloroplast) [Perilla citriodora] YP_009270797.1 ribosomal protein S7 (chloroplast) [Perilla citriodora] YP_009270871.1 ribosomal protein S7 (chloroplast) [Perilla frutescens] YP_009270885.1 ribosomal protein S7 (chloroplast) [Perilla frutescens] YP_009305681.1 ribosomal protein S7 (plastid) [Veronicastrum sibiricum] YP_009305695.1 ribosomal protein S7 (plastid) [Veronicastrum sibiricum] YP_009309324.1 ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] YP_009309337.1 ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] YP_009309411.1 ribosomal protein S7 (chloroplast) [Pogostemon stellatus] YP_009309424.1 ribosomal protein S7 (chloroplast) [Pogostemon stellatus] YP_009309498.1 ribosomal protein S7 (chloroplast) [Paulownia coreana] YP_009309511.1 ribosomal protein S7 (chloroplast) [Paulownia coreana] YP_009309585.1 ribosomal protein S7 (chloroplast) [Paulownia tomentosa] YP_009309598.1 ribosomal protein S7 (chloroplast) [Paulownia tomentosa] YP_009309672.1 ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] YP_009309685.1 ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] YP_009309921.1 ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] YP_009309934.1 ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] YP_009317956.1 ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] YP_009317969.1 ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] YP_009316359.1 ribosomal protein S7 (plastid) [Castilleja paramensis] YP_009316370.1 ribosomal protein S7 (plastid) [Castilleja paramensis] YP_009327434.1 ribosomal protein S7 (chloroplast) [Mentha longifolia] YP_009327447.1 ribosomal protein S7 (chloroplast) [Mentha longifolia] YP_009344483.1 ribosomal protein S7 (chloroplast) [Rehmannia chingii] YP_009344496.1 ribosomal protein S7 (chloroplast) [Rehmannia chingii] ADA69971.1 ribosomal protein S7 (chloroplast) [Olea europaea] ADA69985.1 ribosomal protein S7 (chloroplast) [Olea europaea] ADD29889.1 ribosomal protein S7 (chloroplast) [Antirrhinum majus] ADD72135.1 ribosomal protein S7 (chloroplast) [Olea europaea] ADD72150.1 ribosomal protein S7 (chloroplast) [Olea europaea] CBR30360.1 ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] CBR30374.1 ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] CBR23876.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] CBR23890.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] CBR24670.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] CBR24684.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] CBR30453.1 ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] CBR30468.1 ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] CBS29397.1 ribosomal protein S7 (chloroplast) [Olea woodiana subsp. woodiana] CBS29412.1 ribosomal protein S7 (chloroplast) [Olea woodiana subsp. woodiana] CBS29293.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. maroccana] CBS29309.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. maroccana] CBJ04343.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] CBJ04357.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] CBR23784.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] CBR23798.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] AEK53275.1 ribosomal protein S7 (chloroplast) [Dorcoceras hygrometricum] AEK53289.1 ribosomal protein S7 (chloroplast) [Dorcoceras hygrometricum] AEK53319.1 ribosomal protein S7 (mitochondrion) [Dorcoceras hygrometricum] AEK71665.1 ribosomal protein S7 (plastid) [Antirrhinum majus] AEO92753.1 ribosomal protein S7 (chloroplast) [Sesamum indicum] AEO92766.1 ribosomal protein S7 (chloroplast) [Sesamum indicum] AFQ30975.1 ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] AFQ30990.1 ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] AFV61859.1 ribosomal protein S7 (chloroplast) [Origanum vulgare subsp. vulgare] AFV61872.1 ribosomal protein S7 (chloroplast) [Origanum vulgare subsp. vulgare] CCP47177.1 ribosomal protein S7 (chloroplast) [Tectona grandis] CCP47193.1 ribosomal protein S7 (chloroplast) [Tectona grandis] CCP47266.1 ribosomal protein S7 (chloroplast) [Tectona grandis] CCP47282.1 ribosomal protein S7 (chloroplast) [Tectona grandis] CCP47355.1 ribosomal protein S7 (chloroplast) [Tectona grandis] CCP47371.1 ribosomal protein S7 (chloroplast) [Tectona grandis] AGL45382.1 ribosomal protein S7 (chloroplast) [Sesamum indicum] AGL45395.1 ribosomal protein S7 (chloroplast) [Sesamum indicum] CCQ09147.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] CCQ09161.1 ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] AGU16573.1 ribosomal protein S7 (mitochondrion) [Salvia miltiorrhiza] CDI43964.1 ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] CDI43977.1 ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] CCQ71667.1 ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] CCQ71682.1 ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] CDL78856.1 ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] CDL78860.1 ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] EYU43440.1 hypothetical protein MIMGU_mgv11b012968mg [Erythranthe guttata] CED79807.1 ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] CED79821.1 ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] AJD00771.1 ribosomal protein S7 (plastid) [Scrophularia takesimensis] AJD00786.1 ribosomal protein S7 (plastid) [Scrophularia takesimensis] AJE28422.1 ribosomal protein S7 (chloroplast) [Premna microphylla] AJE28435.1 ribosomal protein S7 (chloroplast) [Premna microphylla] AKJ77776.1 ribosomal protein S7 (chloroplast) [Perilla frutescens] AKJ77785.1 ribosomal protein S7 (chloroplast) [Perilla frutescens] AKM21384.1 ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] AKM21397.1 ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] AKM21471.1 ribosomal protein S7 (chloroplast) [Pogostemon stellatus] AKM21484.1 ribosomal protein S7 (chloroplast) [Pogostemon stellatus] AKM21559.1 ribosomal protein S7 (chloroplast) [Paulownia coreana] AKM21571.1 ribosomal protein S7 (chloroplast) [Paulownia coreana] AKM21646.1 ribosomal protein S7 (chloroplast) [Paulownia tomentosa] AKM21658.1 ribosomal protein S7 (chloroplast) [Paulownia tomentosa] AKM21732.1 ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] AKM21745.1 ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] AKM21819.1 ribosomal protein S7 (chloroplast) [Scrophularia takesimensis] AKM21832.1 ribosomal protein S7 (chloroplast) [Scrophularia takesimensis] AKZ24101.1 ribosomal protein S7 (plastid) [Nepeta cataria] AKZ24103.1 ribosomal protein S7 (plastid) [Penstemon gracilis] AKZ24104.1 ribosomal protein S7 (plastid) [Verbascum thapsus] ALJ01947.1 ribosomal protein S7 (chloroplast) [Scrophularia dentata] ALJ01960.1 ribosomal protein S7 (chloroplast) [Scrophularia dentata] ALZ50064.1 ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] ALZ50077.1 ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] AMA20369.1 ribosomal protein S7 (chloroplast) [Lavandula angustifolia] AMA20370.1 ribosomal protein S7 (chloroplast) [Lavandula angustifolia] AMQ32907.1 ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] AMQ32922.1 ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] AMQ32994.1 ribosomal protein S7 (chloroplast) [Phyllostegia waimeae] AMQ33010.1 ribosomal protein S7 (chloroplast) [Phyllostegia waimeae] AMQ33082.1 ribosomal protein S7 (chloroplast) [Stenogyne bifida] AMQ33098.1 ribosomal protein S7 (chloroplast) [Stenogyne bifida] AMQ33170.1 ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] AMQ33186.1 ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] AMQ33258.1 ribosomal protein S7 (chloroplast) [Phyllostegia velutina] AMQ33274.1 ribosomal protein S7 (chloroplast) [Phyllostegia velutina] AMQ33346.1 ribosomal protein S7 (chloroplast) [Stenogyne sessilis] AMQ33362.1 ribosomal protein S7 (chloroplast) [Stenogyne sessilis] AMQ33434.1 ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] AMQ33450.1 ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] AMQ33522.1 ribosomal protein S7 (chloroplast) [Haplostachys linearifolia] AMQ33538.1 ribosomal protein S7 (chloroplast) [Haplostachys linearifolia] AMQ33610.1 ribosomal protein S7 (chloroplast) [Stachys chamissonis] AMQ33626.1 ribosomal protein S7 (chloroplast) [Stachys chamissonis] AMQ33698.1 ribosomal protein S7 (chloroplast) [Stachys coccinea] AMQ33714.1 ribosomal protein S7 (chloroplast) [Stachys coccinea] AMQ33786.1 ribosomal protein S7 (chloroplast) [Stachys sylvatica] AMQ33802.1 ribosomal protein S7 (chloroplast) [Stachys sylvatica] AMQ33874.1 ribosomal protein S7 (chloroplast) [Stachys byzantina] AMQ33890.1 ribosomal protein S7 (chloroplast) [Stachys byzantina] AMR74155.1 ribosomal protein S7 (chloroplast) [Perilla frutescens] AMR74169.1 ribosomal protein S7 (chloroplast) [Perilla frutescens] AMR74243.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. acuta] AMR74257.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. acuta] AMR74331.1 ribosomal protein S7 (chloroplast) [Perilla frutescens f. crispidiscolor] AMR74345.1 ribosomal protein S7 (chloroplast) [Perilla frutescens f. crispidiscolor] AMR74419.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] AMR74433.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] AMR74507.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] AMR74521.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] AMR74595.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. frutescens] AMR74609.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. frutescens] AMR74683.1 ribosomal protein S7 (chloroplast) [Perilla citriodora] AMR74697.1 ribosomal protein S7 (chloroplast) [Perilla citriodora] AMR74771.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. hirtella] AMR74785.1 ribosomal protein S7 (chloroplast) [Perilla frutescens var. hirtella] AMR74859.1 ribosomal protein S7 (chloroplast) [Perilla setoyensis] AMR74873.1 ribosomal protein S7 (chloroplast) [Perilla setoyensis] ANA57755.1 ribosomal protein S7 (plastid) [Veronicastrum sibiricum] ANA57769.1 ribosomal protein S7 (plastid) [Veronicastrum sibiricum] ANC62960.1 ribosomal protein S7 (chloroplast) [Erythranthe lutea] ANC62973.1 ribosomal protein S7 (chloroplast) [Erythranthe lutea] ANJ04319.1 ribosomal protein S7 (plastid) [Castilleja paramensis] ANJ04331.1 ribosomal protein S7 (plastid) [Castilleja paramensis] ANQ46356.1 rps7 (chloroplast) [Pogostemon cablin] ANX10212.1 ribosomal protein S7 (chloroplast) [Triphysaria versicolor] ANX10224.1 ribosomal protein S7 (chloroplast) [Triphysaria versicolor] AOW32164.1 ribosomal protein S7 (chloroplast) [Mentha longifolia] AOW32165.1 ribosomal protein S7 (chloroplast) [Mentha longifolia] AOY41483.1 ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] AOY41484.1 ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] APT42278.1 ribosomal protein S7 (chloroplast) [Rehmannia chingii] APT42279.1 ribosomal protein S7 (chloroplast) [Rehmannia chingii] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRA+KKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >AEX01324.1 ribosomal protein S7 (plastid) [Pleea tenuifolia] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >AEX01291.1 ribosomal protein S7 (plastid) [Ruppia maritima] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_009241877.1 ribosomal protein S7 (plastid) [Potamogeton perfoliatus] YP_009241890.1 ribosomal protein S7 (plastid) [Potamogeton perfoliatus] AEX01275.1 ribosomal protein S7 (plastid) [Zostera angustifolia] AEX01278.1 ribosomal protein S7 (plastid) [Groenlandia densa] AMQ13452.1 ribosomal protein S7 (plastid) [Potamogeton perfoliatus] AMQ13465.1 ribosomal protein S7 (plastid) [Potamogeton perfoliatus] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_006665826.1 ribosomal protein S7 (chloroplast) [Elodea canadensis] YP_006665839.1 ribosomal protein S7 (chloroplast) [Elodea canadensis] AEX01267.1 ribosomal protein S7 (plastid) [Elodea canadensis] AEY84699.1 ribosomal protein S7 (chloroplast) [Elodea canadensis] AEY84712.1 ribosomal protein S7 (chloroplast) [Elodea canadensis] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >AEX01264.1 ribosomal protein S7 (plastid) [Stratiotes aloides] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >ADK89738.1 ribosomal protein S7 (chloroplast) [Hydrocotyle verticillata] ADK89752.1 ribosomal protein S7 (chloroplast) [Hydrocotyle verticillata] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET +MAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >YP_001595553.1 ribosomal protein S7 [Lemna minor] YP_001595568.1 ribosomal protein S7 [Lemna minor] A9L9E1.1 RecName: Full=30S ribosomal protein S7, chloroplastic ABD48540.1 ribosomal protein S7 (chloroplast) [Lemna minor] ABD48555.1 ribosomal protein S7 (chloroplast) [Lemna minor] AEX01303.1 ribosomal protein S7 (plastid) [Lemna trisulca] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 112/117 (95%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVK+RRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKSRRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >YP_009241792.1 ribosomal protein S7 (plastid) [Tofieldia thibetica] YP_009241805.1 ribosomal protein S7 (plastid) [Tofieldia thibetica] AAN31967.1 ribosomal protein S7 (chloroplast) [Triantha glutinosa] AEX01315.1 ribosomal protein S7 (plastid) [Triantha racemosa] AEX01318.1 ribosomal protein S7 (plastid) [Tofieldia coccinea] AEX01321.1 ribosomal protein S7 (plastid) [Harperocallis flava] AMQ13367.1 ribosomal protein S7 (plastid) [Tofieldia thibetica] AMQ13380.1 ribosomal protein S7 (plastid) [Tofieldia thibetica] Length = 155 Score = 217 bits (553), Expect = 1e-70 Identities = 113/117 (96%), Positives = 114/117 (97%) Frame = -2 Query: 379 AYKIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 200 AY+IIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA Sbjct: 39 AYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKA 98 Query: 199 LAIRWLLVASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETIKMAEANLAFAHFR 29 LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEET KMAEAN AFAHFR Sbjct: 99 LAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155