BLASTX nr result
ID: Alisma22_contig00029675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00029675 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016515187.1 PREDICTED: squamosa promoter-binding-like protein... 65 4e-11 XP_009596192.1 PREDICTED: squamosa promoter-binding-like protein... 65 4e-11 XP_019249702.1 PREDICTED: squamosa promoter-binding protein 1-li... 63 1e-10 ALJ51620.1 squamosa promoter-binding protein 2, partial [Petunia... 61 2e-10 XP_009788885.1 PREDICTED: squamosa promoter-binding-like protein... 63 2e-10 BAM15478.1 SBP-box protein [Torenia fournieri] 63 2e-10 XP_017424410.1 PREDICTED: squamosa promoter-binding-like protein... 63 2e-10 EPS70852.1 squamosa promoter-binding protein 2, partial [Genlise... 60 5e-10 XP_010502692.1 PREDICTED: squamosa promoter-binding-like protein... 62 7e-10 XP_004485802.1 PREDICTED: squamosa promoter-binding-like protein... 61 7e-10 ALJ51615.1 squamosa promoter-binding protein 1, partial [Delospe... 59 7e-10 EPS59677.1 hypothetical protein M569_15126, partial [Genlisea au... 59 8e-10 KNA07253.1 hypothetical protein SOVF_172970 isoform B [Spinacia ... 60 9e-10 KOM43732.1 hypothetical protein LR48_Vigan05g133700 [Vigna angul... 63 9e-10 ALJ51617.1 squamosa promoter-binding protein 1b, partial [Penste... 58 1e-09 ALJ51618.1 squamosa promoter-binding protein 1, partial [Ruellia... 58 1e-09 XP_011628897.1 PREDICTED: squamosa promoter-binding-like protein... 61 1e-09 XP_016579534.1 PREDICTED: squamosa promoter-binding-like protein... 60 1e-09 EPS57302.1 hypothetical protein M569_17517, partial [Genlisea au... 59 2e-09 EAZ39937.1 hypothetical protein OsJ_24374 [Oryza sativa Japonica... 60 2e-09 >XP_016515187.1 PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana tabacum] Length = 172 Score = 64.7 bits (156), Expect = 4e-11 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNIS-EEPPCR 133 QQCSRFHE S+FDG +RSCRRRLA HNERRRK+ +I E+ CR Sbjct: 103 QQCSRFHEVSEFDGTKRSCRRRLAGHNERRRKIPLSIKLEDNQCR 147 >XP_009596192.1 PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana tomentosiformis] Length = 172 Score = 64.7 bits (156), Expect = 4e-11 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNIS-EEPPCR 133 QQCSRFHE S+FDG +RSCRRRLA HNERRRK+ +I E+ CR Sbjct: 103 QQCSRFHEVSEFDGTKRSCRRRLAGHNERRRKIPLSIKLEDNQCR 147 >XP_019249702.1 PREDICTED: squamosa promoter-binding protein 1-like [Nicotiana attenuata] Length = 165 Score = 63.2 bits (152), Expect = 1e-10 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNIS-EEPPCR 133 QQCSRFHE S+FDG +RSCRRRLA HNERRRK I E+ CR Sbjct: 96 QQCSRFHEVSEFDGTKRSCRRRLAGHNERRRKTPLAIKLEDDQCR 140 >ALJ51620.1 squamosa promoter-binding protein 2, partial [Petunia x hybrida] Length = 94 Score = 61.2 bits (147), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE S+FDG +RSCRRRLA HNERRRK Sbjct: 25 QQCSRFHELSEFDGTKRSCRRRLAGHNERRRK 56 >XP_009788885.1 PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana sylvestris] XP_016481940.1 PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana tabacum] Length = 165 Score = 62.8 bits (151), Expect = 2e-10 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNIS-EEPPCR 133 QQCSRFHE S+FDG +RSCRRRLA HNERRRK I E+ CR Sbjct: 96 QQCSRFHEVSEFDGTKRSCRRRLAGHNERRRKTPLAIKLEDNQCR 140 >BAM15478.1 SBP-box protein [Torenia fournieri] Length = 177 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNI 112 QQCSRFHE S+FD +RSCRRRLA HNERRRKMI ++ Sbjct: 123 QQCSRFHELSEFDEAKRSCRRRLAGHNERRRKMIISV 159 >XP_017424410.1 PREDICTED: squamosa promoter-binding-like protein 3 [Vigna angularis] BAT92300.1 hypothetical protein VIGAN_07099600 [Vigna angularis var. angularis] Length = 182 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNISE 118 QQCSRFHE S+FD +RSCRRRLA HNERRRK C+ S+ Sbjct: 99 QQCSRFHELSEFDDAKRSCRRRLAVHNERRRKNSCDQSQ 137 >EPS70852.1 squamosa promoter-binding protein 2, partial [Genlisea aurea] Length = 87 Score = 59.7 bits (143), Expect = 5e-10 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE SQFD +RSCRRRLA HNERRRK Sbjct: 47 QQCSRFHEVSQFDHTKRSCRRRLAGHNERRRK 78 >XP_010502692.1 PREDICTED: squamosa promoter-binding-like protein 5 [Camelina sativa] Length = 181 Score = 61.6 bits (148), Expect = 7e-10 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNISEE 121 QQCSRFHE +FD +RSCRRRLA HNERRRK+ C+I E Sbjct: 105 QQCSRFHELPEFDEAKRSCRRRLAGHNERRRKISCDIYGE 144 >XP_004485802.1 PREDICTED: squamosa promoter-binding-like protein 3 [Cicer arietinum] Length = 145 Score = 60.8 bits (146), Expect = 7e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNISE 118 QQCSRFHE S+FD +RSCRRRLA HNERRRK N+SE Sbjct: 102 QQCSRFHEVSEFDELKRSCRRRLAGHNERRRK---NVSE 137 >ALJ51615.1 squamosa promoter-binding protein 1, partial [Delosperma cooperi] Length = 71 Score = 58.9 bits (141), Expect = 7e-10 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNI 112 QQCSRFHE S+FD +RSCRRRLA HNERRRK +I Sbjct: 28 QQCSRFHELSEFDDTKRSCRRRLAGHNERRRKCSSDI 64 >EPS59677.1 hypothetical protein M569_15126, partial [Genlisea aurea] Length = 76 Score = 58.9 bits (141), Expect = 8e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE S+FD +RSCRRRLA HNERRRK Sbjct: 43 QQCSRFHELSEFDDVKRSCRRRLAGHNERRRK 74 >KNA07253.1 hypothetical protein SOVF_172970 isoform B [Spinacia oleracea] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNISEE 121 QQCS+FH+TS+FD +RSCR+RLA HNERRRK ++S E Sbjct: 66 QQCSKFHDTSEFDDTKRSCRKRLAGHNERRRKNSYDVSAE 105 >KOM43732.1 hypothetical protein LR48_Vigan05g133700 [Vigna angularis] Length = 347 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNISE 118 QQCSRFHE S+FD +RSCRRRLA HNERRRK C+ S+ Sbjct: 264 QQCSRFHELSEFDDAKRSCRRRLAVHNERRRKNSCDQSQ 302 >ALJ51617.1 squamosa promoter-binding protein 1b, partial [Penstemon barbatus] Length = 55 Score = 58.2 bits (139), Expect = 1e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE S+FD +RSCRRRLA HNERRRK Sbjct: 19 QQCSRFHELSEFDEAKRSCRRRLAGHNERRRK 50 >ALJ51618.1 squamosa promoter-binding protein 1, partial [Ruellia brittoniana] Length = 65 Score = 58.2 bits (139), Expect = 1e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE S+FD +RSCRRRLA HNERRRK Sbjct: 28 QQCSRFHEISEFDEAKRSCRRRLAGHNERRRK 59 >XP_011628897.1 PREDICTED: squamosa promoter-binding-like protein 3 [Amborella trichopoda] Length = 185 Score = 60.8 bits (146), Expect = 1e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE SQFD +RSCR RLACHN+RRRK Sbjct: 114 QQCSRFHEVSQFDEAKRSCRNRLACHNKRRRK 145 >XP_016579534.1 PREDICTED: squamosa promoter-binding-like protein 3 [Capsicum annuum] Length = 169 Score = 60.5 bits (145), Expect = 1e-09 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNIS-EEPPCR 133 QQCSRFHE S+FDG +RSCR+RLA HN+RRRK+ + E+ CR Sbjct: 111 QQCSRFHEISEFDGTKRSCRQRLAGHNQRRRKIPVAVKLEDDQCR 155 >EPS57302.1 hypothetical protein M569_17517, partial [Genlisea aurea] Length = 87 Score = 58.5 bits (140), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRK 97 QQCSRFHE S+FD +RSCRRRLA HNERRRK Sbjct: 56 QQCSRFHEVSEFDEAKRSCRRRLAGHNERRRK 87 >EAZ39937.1 hypothetical protein OsJ_24374 [Oryza sativa Japonica Group] Length = 175 Score = 60.5 bits (145), Expect = 2e-09 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 2 QQCSRFHETSQFDGFRRSCRRRLACHNERRRKMICNISEEPPCR 133 QQCSRFHE ++FD +RSCRRRLA HNERRRK + + CR Sbjct: 111 QQCSRFHELTEFDDAKRSCRRRLAGHNERRRKSAADTAHGENCR 154