BLASTX nr result
ID: Alisma22_contig00028862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00028862 (204 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV54069.1 Beta-galactosidase [Dorcoceras hygrometricum] 57 7e-08 XP_016675439.1 PREDICTED: uncharacterized protein LOC107894697 [... 52 4e-06 >KZV54069.1 Beta-galactosidase [Dorcoceras hygrometricum] Length = 870 Score = 57.0 bits (136), Expect = 7e-08 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 2 GYSPTQKGYKCYCPHLHCMFVSADATFH*STQFFSDYVQ 118 GYSPTQKGYKC+ PH H +FVS D TF S QFFS +Q Sbjct: 682 GYSPTQKGYKCFDPHSHTIFVSLDVTFCESQQFFSTPLQ 720 >XP_016675439.1 PREDICTED: uncharacterized protein LOC107894697 [Gossypium hirsutum] Length = 2240 Score = 52.0 bits (123), Expect = 4e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 2 GYSPTQKGYKCYCPHLHCMFVSADATFH*STQFFS 106 GYSP QKGYKCY P LH MFVS D TF + +FS Sbjct: 1580 GYSPAQKGYKCYSPTLHRMFVSLDVTFFENEPYFS 1614