BLASTX nr result
ID: Alisma22_contig00028765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00028765 (663 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009358331.1 PREDICTED: zinc finger protein ZAT12-like [Pyrus ... 57 2e-06 XP_008357752.1 PREDICTED: zinc finger protein ZAT12 [Malus domes... 57 2e-06 XP_009338354.1 PREDICTED: zinc finger protein ZAT12-like [Pyrus ... 57 3e-06 XP_019192386.1 PREDICTED: zinc finger protein ZAT11-like [Ipomoe... 55 7e-06 >XP_009358331.1 PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri] Length = 173 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 3 HQCPICGLVFSMGQALGGHMRRHKDVIGA 89 H+CPICGL F++GQALGGHMRRH+DVI A Sbjct: 92 HECPICGLEFTVGQALGGHMRRHRDVIQA 120 >XP_008357752.1 PREDICTED: zinc finger protein ZAT12 [Malus domestica] Length = 173 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 3 HQCPICGLVFSMGQALGGHMRRHKDVIGA 89 H+CPICGL F++GQALGGHMRRH+DVI A Sbjct: 92 HECPICGLEFTVGQALGGHMRRHRDVIQA 120 >XP_009338354.1 PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri] Length = 238 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 3 HQCPICGLVFSMGQALGGHMRRHKDVIGA 89 H+CPICGL F++GQALGGHMRRH+DVI A Sbjct: 157 HECPICGLEFAIGQALGGHMRRHRDVIQA 185 >XP_019192386.1 PREDICTED: zinc finger protein ZAT11-like [Ipomoea nil] Length = 189 Score = 55.1 bits (131), Expect = 7e-06 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +3 Query: 3 HQCPICGLVFSMGQALGGHMRRHKDVIGAKSNHCSKYGN 119 H+C ICG+ F++GQALGGHMRRH+ V+ +H S +G+ Sbjct: 104 HECSICGVEFALGQALGGHMRRHRSVMNNNDSHSSGHGD 142