BLASTX nr result
ID: Alisma22_contig00028397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00028397 (264 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009415876.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 5e-06 XP_010915324.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 9e-06 XP_019702465.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 9e-06 >XP_009415876.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 531 Score = 52.8 bits (125), Expect = 5e-06 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +1 Query: 46 SPESAPPLPDANLGF-DFTGDSPPNPSPRRITLCPEADSLACLLIEHHNPFHAME 207 SP S D +LG D D+P P+P I EAD+LA LL++HHNPFHAME Sbjct: 22 SPRSLSGSLDPDLGLPDEVADAPAKPTPPPIEPSAEADALARLLLQHHNPFHAME 76 >XP_010915324.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Elaeis guineensis] Length = 527 Score = 52.0 bits (123), Expect = 9e-06 Identities = 30/64 (46%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +1 Query: 22 RLSLSEPDSPE--SAPPLPDANLGFDFTGDSPPNPSPRRITLCPEADSLACLLIEHHNPF 195 R L P P S PLP+ LGF S P PSP + +AD+LA LLI HHNPF Sbjct: 11 RRHLLPPPKPRLLSHSPLPELGLGFS---GSSPKPSPPPLRPSDDADALARLLIHHHNPF 67 Query: 196 HAME 207 H +E Sbjct: 68 HPLE 71 >XP_019702465.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Elaeis guineensis] Length = 530 Score = 52.0 bits (123), Expect = 9e-06 Identities = 30/64 (46%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +1 Query: 22 RLSLSEPDSPE--SAPPLPDANLGFDFTGDSPPNPSPRRITLCPEADSLACLLIEHHNPF 195 R L P P S PLP+ LGF S P PSP + +AD+LA LLI HHNPF Sbjct: 11 RRHLLPPPKPRLLSHSPLPELGLGFS---GSSPKPSPPPLRPSDDADALARLLIHHHNPF 67 Query: 196 HAME 207 H +E Sbjct: 68 HPLE 71