BLASTX nr result
ID: Alisma22_contig00028313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00028313 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010929507.1 PREDICTED: uncharacterized protein LOC105050971 [... 54 9e-07 XP_008797089.1 PREDICTED: uncharacterized protein LOC103712363 [... 53 2e-06 >XP_010929507.1 PREDICTED: uncharacterized protein LOC105050971 [Elaeis guineensis] XP_019708193.1 PREDICTED: uncharacterized protein LOC105050971 [Elaeis guineensis] Length = 323 Score = 54.3 bits (129), Expect = 9e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 137 MAVLLYHMFSFLVLFSYGLYHLVCSTRAHLLQPLTKSPPS 18 MAVL+YH+F+F L SYGLYHL+ +TRAHL P SPPS Sbjct: 1 MAVLVYHIFAFFSLSSYGLYHLISATRAHLKHP---SPPS 37 >XP_008797089.1 PREDICTED: uncharacterized protein LOC103712363 [Phoenix dactylifera] Length = 325 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = -2 Query: 137 MAVLLYHMFSFLVLFSYGLYHLVCSTRAHLLQPLTKSPPS 18 MAVL+YH+F+F L SYGLYHL+ +TRAHL P S S Sbjct: 1 MAVLVYHIFAFFALSSYGLYHLISATRAHLKHPSPSSSSS 40