BLASTX nr result
ID: Alisma22_contig00028163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00028163 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH76172.1 hypothetical protein GLYMA_01G136700 [Glycine max] 53 6e-06 >KRH76172.1 hypothetical protein GLYMA_01G136700 [Glycine max] Length = 605 Score = 53.1 bits (126), Expect = 6e-06 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = +1 Query: 70 TKRRNHLAQDSLNKLVYVIYNLKLRGVRTKTMEDHVVFEFINCNDEWIVK 219 TKRRN L Q +N LVYVIYNLKL+ + K + F+ I +DEWI++ Sbjct: 474 TKRRNRLHQQKMNDLVYVIYNLKLKSKQNKKKSIALPFDEIESDDEWIIE 523