BLASTX nr result
ID: Alisma22_contig00027545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00027545 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT59742.1 Protein argonaute 4A [Anthurium amnicola] 77 2e-14 XP_016578032.1 PREDICTED: protein argonaute 4 [Capsicum annuum] ... 74 2e-13 XP_015079261.1 PREDICTED: protein argonaute 4-like isoform X5 [S... 74 3e-13 XP_006347268.1 PREDICTED: protein argonaute 4 [Solanum tuberosum... 74 3e-13 NP_001289847.1 Argonaute 4B [Solanum lycopersicum] AFV15382.1 AG... 74 3e-13 XP_015079260.1 PREDICTED: protein argonaute 4-like isoform X4 [S... 74 3e-13 XP_015079258.1 PREDICTED: protein argonaute 4-like isoform X2 [S... 74 3e-13 XP_015079257.1 PREDICTED: protein argonaute 4-like isoform X1 [S... 74 3e-13 ONK67446.1 uncharacterized protein A4U43_C05F120 [Asparagus offi... 73 4e-13 OAY58827.1 hypothetical protein MANES_02G209900 [Manihot esculenta] 73 4e-13 XP_015056100.1 PREDICTED: protein argonaute 4 [Solanum pennellii] 73 5e-13 XP_006362741.1 PREDICTED: protein argonaute 4 [Solanum tuberosum] 73 5e-13 NP_001266156.1 argonaute 4A [Solanum lycopersicum] AFV15381.1 AG... 73 5e-13 XP_016577953.1 PREDICTED: protein argonaute 4-like [Capsicum ann... 73 5e-13 XP_020097102.1 protein argonaute 4B-like isoform X2 [Ananas como... 72 8e-13 XP_020097101.1 protein argonaute 4B-like isoform X1 [Ananas como... 72 8e-13 BAS87802.1 Os04g0151800, partial [Oryza sativa Japonica Group] 72 9e-13 XP_008805346.1 PREDICTED: protein argonaute 4B-like isoform X2 [... 72 9e-13 KQL13953.1 hypothetical protein SETIT_021147mg [Setaria italica] 72 9e-13 OAY80372.1 Protein argonaute 4A [Ananas comosus] 72 9e-13 >JAT59742.1 Protein argonaute 4A [Anthurium amnicola] Length = 915 Score = 76.6 bits (187), Expect = 2e-14 Identities = 36/58 (62%), Positives = 46/58 (79%) Frame = -2 Query: 206 KTCNIGRH*IVFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 K NI + V+EE+PSMRRAP NVRVD M E M++KLPG+P+FLLC+L ++KN DVY Sbjct: 525 KGINIEQPFDVYEENPSMRRAPANVRVDTMFEQMRSKLPGMPRFLLCLLPERKNSDVY 582 >XP_016578032.1 PREDICTED: protein argonaute 4 [Capsicum annuum] XP_016578033.1 PREDICTED: protein argonaute 4 [Capsicum annuum] Length = 909 Score = 73.9 bits (180), Expect = 2e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 529 VFEESPQLRRAPPMVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 576 >XP_015079261.1 PREDICTED: protein argonaute 4-like isoform X5 [Solanum pennellii] Length = 913 Score = 73.6 bits (179), Expect = 3e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 533 VFEESPQLRRAPPVVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 580 >XP_006347268.1 PREDICTED: protein argonaute 4 [Solanum tuberosum] XP_006347269.1 PREDICTED: protein argonaute 4 [Solanum tuberosum] XP_015164242.1 PREDICTED: protein argonaute 4 [Solanum tuberosum] Length = 913 Score = 73.6 bits (179), Expect = 3e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 533 VFEESPQLRRAPPVVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 580 >NP_001289847.1 Argonaute 4B [Solanum lycopersicum] AFV15382.1 AGO4B [Solanum lycopersicum] Length = 913 Score = 73.6 bits (179), Expect = 3e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 533 VFEESPQLRRAPPVVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 580 >XP_015079260.1 PREDICTED: protein argonaute 4-like isoform X4 [Solanum pennellii] Length = 919 Score = 73.6 bits (179), Expect = 3e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 539 VFEESPQLRRAPPVVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 586 >XP_015079258.1 PREDICTED: protein argonaute 4-like isoform X2 [Solanum pennellii] Length = 921 Score = 73.6 bits (179), Expect = 3e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 541 VFEESPQLRRAPPVVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 588 >XP_015079257.1 PREDICTED: protein argonaute 4-like isoform X1 [Solanum pennellii] XP_015079259.1 PREDICTED: protein argonaute 4-like isoform X3 [Solanum pennellii] Length = 921 Score = 73.6 bits (179), Expect = 3e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRVD+M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 541 VFEESPQLRRAPPVVRVDKMFEEIQSKLPGAPKFLLCLLPERKNCDIY 588 >ONK67446.1 uncharacterized protein A4U43_C05F120 [Asparagus officinalis] Length = 889 Score = 73.2 bits (178), Expect = 4e-13 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 179 IVFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 +V EE+PSMRRAP RV++M E +K+KLPG PKFLLC+LS++KN DVY Sbjct: 499 VVLEENPSMRRAPAPARVEDMFEQIKSKLPGAPKFLLCLLSERKNSDVY 547 >OAY58827.1 hypothetical protein MANES_02G209900 [Manihot esculenta] Length = 908 Score = 73.2 bits (178), Expect = 4e-13 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRV++M E +++KLPG PKFLLC+L ++KN D+Y Sbjct: 528 VFEESPQLRRAPPTVRVEKMFEEIQSKLPGAPKFLLCLLPERKNSDIY 575 >XP_015056100.1 PREDICTED: protein argonaute 4 [Solanum pennellii] Length = 909 Score = 72.8 bits (177), Expect = 5e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRV++M E +++KLPG PKFLLC+L ++KN DVY Sbjct: 529 VFEESPQVRRAPPLVRVEKMFEQVQSKLPGAPKFLLCLLPERKNCDVY 576 >XP_006362741.1 PREDICTED: protein argonaute 4 [Solanum tuberosum] Length = 909 Score = 72.8 bits (177), Expect = 5e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRV++M E +++KLPG PKFLLC+L ++KN DVY Sbjct: 529 VFEESPQVRRAPPLVRVEKMFEQVQSKLPGAPKFLLCLLPERKNCDVY 576 >NP_001266156.1 argonaute 4A [Solanum lycopersicum] AFV15381.1 AGO4A [Solanum lycopersicum] Length = 909 Score = 72.8 bits (177), Expect = 5e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRV++M E +++KLPG PKFLLC+L ++KN DVY Sbjct: 529 VFEESPQVRRAPPLVRVEKMFEQVQSKLPGAPKFLLCLLPERKNCDVY 576 >XP_016577953.1 PREDICTED: protein argonaute 4-like [Capsicum annuum] Length = 910 Score = 72.8 bits (177), Expect = 5e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP VRV++M E +++KLPG PKFLLC+L ++KN DVY Sbjct: 530 VFEESPQVRRAPPLVRVEKMFEQVQSKLPGAPKFLLCLLPERKNCDVY 577 >XP_020097102.1 protein argonaute 4B-like isoform X2 [Ananas comosus] Length = 423 Score = 72.0 bits (175), Expect = 8e-13 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP RV++M + +K KLPG P+FLLC+L ++KN DVY Sbjct: 234 VFEESPQLRRAPPTARVEDMFQQIKTKLPGAPRFLLCLLPERKNCDVY 281 >XP_020097101.1 protein argonaute 4B-like isoform X1 [Ananas comosus] Length = 426 Score = 72.0 bits (175), Expect = 8e-13 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP RV++M + +K KLPG P+FLLC+L ++KN DVY Sbjct: 237 VFEESPQLRRAPPTARVEDMFQQIKTKLPGAPRFLLCLLPERKNCDVY 284 >BAS87802.1 Os04g0151800, partial [Oryza sativa Japonica Group] Length = 521 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESPS+RRAP + RVD+M E +K+KLPG PKFLLC+L ++KN +VY Sbjct: 142 VFEESPSLRRAPVSRRVDDMFEQIKSKLPGAPKFLLCLLPERKNCEVY 189 >XP_008805346.1 PREDICTED: protein argonaute 4B-like isoform X2 [Phoenix dactylifera] Length = 852 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEE+PSMRRA P RV++M E +K+KLPG P+FLLC+LS++KN DVY Sbjct: 538 VFEENPSMRRALPAARVEDMFERIKSKLPGAPRFLLCLLSERKNSDVY 585 >KQL13953.1 hypothetical protein SETIT_021147mg [Setaria italica] Length = 872 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 +FEESPSMRRAP + RVD+M E +K+KLPG PKFLLC+L ++KN +VY Sbjct: 493 MFEESPSMRRAPVSRRVDDMFEQIKSKLPGAPKFLLCLLPERKNCEVY 540 >OAY80372.1 Protein argonaute 4A [Ananas comosus] Length = 898 Score = 72.0 bits (175), Expect = 9e-13 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -2 Query: 176 VFEESPSMRRAPPNVRVDEMIEMMKNKLPGVPKFLLCILSQQKNYDVY 33 VFEESP +RRAPP RV++M + +K KLPG P+FLLC+L ++KN DVY Sbjct: 561 VFEESPQLRRAPPTARVEDMFQQIKTKLPGAPRFLLCLLPERKNCDVY 608