BLASTX nr result
ID: Alisma22_contig00027300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00027300 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP16662.1 unnamed protein product [Coffea canephora] 94 2e-20 ONM56454.1 Lysine histidine transporter 2 [Zea mays] 89 2e-20 XP_015695482.1 PREDICTED: lysine histidine transporter-like 2 [O... 91 3e-20 CAC12825.1 amino acid permease, partial [Nicotiana tabacum] 86 3e-20 KXG24322.1 hypothetical protein SORBI_007G025500 [Sorghum bicolor] 93 5e-20 KQL00977.1 hypothetical protein SETIT_013740mg [Setaria italica] 92 5e-20 XP_004972971.1 PREDICTED: lysine histidine transporter 2-like [S... 92 6e-20 CAD89802.1 histidine amino acid transporter [Oryza sativa Indica... 91 2e-19 XP_015649754.1 PREDICTED: lysine histidine transporter 1 [Oryza ... 91 2e-19 KRG94431.1 hypothetical protein GLYMA_19G084200 [Glycine max] 89 3e-19 XP_010250839.1 PREDICTED: lysine histidine transporter 1-like [N... 91 3e-19 NP_001147827.1 LHT1 [Zea mays] ACG28821.1 LHT1 [Zea mays] AQK784... 91 3e-19 KQL00975.1 hypothetical protein SETIT_013742mg [Setaria italica] 90 4e-19 OAY63348.1 Lysine histidine transporter 1, partial [Ananas comosus] 88 4e-19 XP_004972967.1 PREDICTED: lysine histidine transporter 1-like [S... 90 4e-19 JAT43445.1 Lysine histidine transporter 1, partial [Anthurium am... 89 5e-19 XP_020083069.1 lysine histidine transporter 1-like isoform X1 [A... 90 6e-19 XP_009385141.1 PREDICTED: lysine histidine transporter 1-like is... 90 6e-19 XP_010111626.1 hypothetical protein L484_017652 [Morus notabilis... 90 6e-19 OEL15693.1 Lysine histidine transporter 1 [Dichanthelium oligosa... 90 8e-19 >CDP16662.1 unnamed protein product [Coffea canephora] Length = 451 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRRYSLSW+TNWICIILGVLLM+I+ IGGLR+IIL T+K Sbjct: 397 LPCIMWLAIYKPRRYSLSWITNWICIILGVLLMVIAPIGGLRQIILEAKTYK 448 >ONM56454.1 Lysine histidine transporter 2 [Zea mays] Length = 160 Score = 89.0 bits (219), Expect = 2e-20 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWL IYKPRR+SLSWLTNWICI++GVLLM++S IGGLR++IL T+K Sbjct: 98 LPCIMWLIIYKPRRFSLSWLTNWICIVIGVLLMVLSPIGGLRQMILKIKTYK 149 >XP_015695482.1 PREDICTED: lysine histidine transporter-like 2 [Oryza brachyantha] Length = 264 Score = 91.3 bits (225), Expect = 3e-20 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW TNWICIILGVLLM++S IGGLR+II+ T+K Sbjct: 210 LPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMVLSPIGGLRQIIMDAKTYK 261 >CAC12825.1 amino acid permease, partial [Nicotiana tabacum] Length = 80 Score = 86.3 bits (212), Expect = 3e-20 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW+ NWICII GVLLM+++ IGGLR II+ T+K Sbjct: 26 LPCIMWLAIYKPRRWSLSWIANWICIIFGVLLMVLAPIGGLRSIIVQAQTYK 77 >KXG24322.1 hypothetical protein SORBI_007G025500 [Sorghum bicolor] Length = 451 Score = 92.8 bits (229), Expect = 5e-20 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKP+R+SLSWLTNWICIILGVLLM++S IGGLR+IIL T+K Sbjct: 397 LPCIMWLAIYKPKRFSLSWLTNWICIILGVLLMILSPIGGLRQIILDAKTYK 448 >KQL00977.1 hypothetical protein SETIT_013740mg [Setaria italica] Length = 399 Score = 92.4 bits (228), Expect = 5e-20 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW TNWICIILGVLLM++S IGGLR+II+ T+K Sbjct: 345 LPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMILSPIGGLRQIIMDSKTYK 396 >XP_004972971.1 PREDICTED: lysine histidine transporter 2-like [Setaria italica] KQL00978.1 hypothetical protein SETIT_013740mg [Setaria italica] Length = 446 Score = 92.4 bits (228), Expect = 6e-20 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW TNWICIILGVLLM++S IGGLR+II+ T+K Sbjct: 392 LPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMILSPIGGLRQIIMDSKTYK 443 >CAD89802.1 histidine amino acid transporter [Oryza sativa Indica Group] Length = 441 Score = 90.9 bits (224), Expect = 2e-19 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW TNWICIILGV+LM++S IGGLR+II+ T+K Sbjct: 387 LPCIMWLAIYKPRRFSLSWFTNWICIILGVMLMILSPIGGLRQIIIDAKTYK 438 >XP_015649754.1 PREDICTED: lysine histidine transporter 1 [Oryza sativa Japonica Group] BAD08858.1 putative histidine amino acid transporter [Oryza sativa Japonica Group] BAF22815.1 Os08g0127100 [Oryza sativa Japonica Group] BAG89420.1 unnamed protein product [Oryza sativa Japonica Group] BAG95342.1 unnamed protein product [Oryza sativa Japonica Group] EEC82845.1 hypothetical protein OsI_27668 [Oryza sativa Indica Group] EEE67980.1 hypothetical protein OsJ_25900 [Oryza sativa Japonica Group] BAT03668.1 Os08g0127100 [Oryza sativa Japonica Group] Length = 447 Score = 90.9 bits (224), Expect = 2e-19 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW TNWICIILGV+LM++S IGGLR+II+ T+K Sbjct: 393 LPCIMWLAIYKPRRFSLSWFTNWICIILGVMLMILSPIGGLRQIIIDAKTYK 444 >KRG94431.1 hypothetical protein GLYMA_19G084200 [Glycine max] Length = 261 Score = 88.6 bits (218), Expect = 3e-19 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*TH 154 LPCIMWLAIYKPR++SLSW+TNWICI+LG+LLM++S IGGLR IIL+ T+ Sbjct: 207 LPCIMWLAIYKPRKFSLSWITNWICIVLGLLLMILSPIGGLRSIILNAKTY 257 >XP_010250839.1 PREDICTED: lysine histidine transporter 1-like [Nelumbo nucifera] Length = 444 Score = 90.5 bits (223), Expect = 3e-19 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW NWICIILGVLLM+IS IGGLR+II+ T+K Sbjct: 390 LPCIMWLAIYKPRRFSLSWFANWICIILGVLLMIISPIGGLRQIIIQAKTYK 441 >NP_001147827.1 LHT1 [Zea mays] ACG28821.1 LHT1 [Zea mays] AQK78448.1 LHT1 [Zea mays] Length = 472 Score = 90.5 bits (223), Expect = 3e-19 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKP+R+SLSW TNWICIILGVLLM+++ IGGLR+II+S T+K Sbjct: 418 LPCIMWLAIYKPKRFSLSWFTNWICIILGVLLMVLAPIGGLRQIIISAKTYK 469 >KQL00975.1 hypothetical protein SETIT_013742mg [Setaria italica] Length = 445 Score = 90.1 bits (222), Expect = 4e-19 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPC+MWLAIYKPRR+SLSW TNWICI+LGVLLM+++ IGGLR IIL+ T+K Sbjct: 391 LPCVMWLAIYKPRRFSLSWFTNWICIVLGVLLMVLAPIGGLRNIILNAKTYK 442 >OAY63348.1 Lysine histidine transporter 1, partial [Ananas comosus] Length = 252 Score = 87.8 bits (216), Expect = 4e-19 Identities = 38/52 (73%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLA+YKP+R+SLSW+TNWICI+LGVLLM++S IG LR IILS ++K Sbjct: 198 LPCIMWLALYKPKRFSLSWITNWICIVLGVLLMVLSPIGALRSIILSAKSYK 249 >XP_004972967.1 PREDICTED: lysine histidine transporter 1-like [Setaria italica] Length = 451 Score = 90.1 bits (222), Expect = 4e-19 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPC+MWLAIYKPRR+SLSW TNWICI+LGVLLM+++ IGGLR IIL+ T+K Sbjct: 397 LPCVMWLAIYKPRRFSLSWFTNWICIVLGVLLMVLAPIGGLRNIILNAKTYK 448 >JAT43445.1 Lysine histidine transporter 1, partial [Anthurium amnicola] Length = 302 Score = 88.6 bits (218), Expect = 5e-19 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKP+R+SLSW TNWICIILGVLLM+I+ IG LR+IIL T+K Sbjct: 250 LPCIMWLAIYKPKRFSLSWFTNWICIILGVLLMIIAPIGALRQIILQAKTYK 301 >XP_020083069.1 lysine histidine transporter 1-like isoform X1 [Ananas comosus] XP_020083078.1 lysine histidine transporter 1-like isoform X2 [Ananas comosus] Length = 441 Score = 89.7 bits (221), Expect = 6e-19 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKP+R+S SW+TNWICIILGVLLM++S IGGLR+II++ T+K Sbjct: 387 LPCIMWLAIYKPKRWSFSWITNWICIILGVLLMILSPIGGLRQIIINAKTYK 438 >XP_009385141.1 PREDICTED: lysine histidine transporter 1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 447 Score = 89.7 bits (221), Expect = 6e-19 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPRR+SLSW TNWICI+LGV+LM++S+IGGLR+I+L T++ Sbjct: 393 LPCIMWLAIYKPRRFSLSWTTNWICILLGVMLMILSSIGGLRQIVLQAKTYR 444 >XP_010111626.1 hypothetical protein L484_017652 [Morus notabilis] EXC31371.1 hypothetical protein L484_017652 [Morus notabilis] Length = 448 Score = 89.7 bits (221), Expect = 6e-19 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWLAIYKPR+YSLSW TNWICI+LGVLLM++S IGGLR+II+ T++ Sbjct: 394 LPCIMWLAIYKPRKYSLSWCTNWICIVLGVLLMILSPIGGLRQIIIQAKTYE 445 >OEL15693.1 Lysine histidine transporter 1 [Dichanthelium oligosanthes] Length = 860 Score = 89.7 bits (221), Expect = 8e-19 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +2 Query: 2 LPCIMWLAIYKPRRYSLSWLTNWICIILGVLLMLISAIGGLRKIILSD*THK 157 LPCIMWL IYKP+R+SLSW TNWICIILGVLLM++S IGGLR+IIL T+K Sbjct: 806 LPCIMWLTIYKPKRFSLSWFTNWICIILGVLLMILSPIGGLRQIILKARTYK 857