BLASTX nr result
ID: Alisma22_contig00026984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00026984 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ62451.1 hypothetical protein ZOSMA_461G00020 [Zostera marina] 58 4e-08 >KMZ62451.1 hypothetical protein ZOSMA_461G00020 [Zostera marina] Length = 374 Score = 58.2 bits (139), Expect = 4e-08 Identities = 27/72 (37%), Positives = 44/72 (61%) Frame = -1 Query: 229 ISQKQHVLLKDQKGKLFSTMLIHTTRKRTVFGRGWINFAAANNVKVDDVCEFRPDPNFST 50 I++K + LKD K +L+ + H++ RTV RGW F +N ++ D EF+ PN + Sbjct: 181 ITRKSKLFLKDPKSELWPVEITHSSNNRTVLTRGWKEFCLSNKLRPGDDVEFQLAPNENG 240 Query: 49 NSIIVVNVLRKS 14 N I++V ++RKS Sbjct: 241 NIILLVRIIRKS 252