BLASTX nr result
ID: Alisma22_contig00026656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00026656 (621 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGE32506.1 hypothetical protein 816152, partial [Populus pruinos... 89 1e-19 AQM54271.1 hypothetical protein 816152, partial [Populus pruinos... 89 2e-19 XP_016200797.1 PREDICTED: protein trichome birefringence-like 11... 91 2e-19 XP_015960795.1 PREDICTED: protein trichome birefringence-like 11... 91 2e-19 AGE32507.1 hypothetical protein 816152, partial [Populus pruinos... 88 2e-19 XP_019444493.1 PREDICTED: protein trichome birefringence-like 10... 95 2e-19 XP_019444492.1 PREDICTED: protein trichome birefringence-like 10... 95 2e-19 AQM54265.1 hypothetical protein 816152, partial [Populus pruinos... 87 9e-19 XP_014496188.1 PREDICTED: protein trichome birefringence-like 10... 92 2e-18 KOM30111.1 hypothetical protein LR48_Vigan902s000800 [Vigna angu... 92 2e-18 KYP43217.1 hypothetical protein KK1_035358 [Cajanus cajan] 92 2e-18 XP_017411061.1 PREDICTED: protein trichome birefringence-like 10... 92 2e-18 XP_007162412.1 hypothetical protein PHAVU_001G150000g [Phaseolus... 92 2e-18 XP_015958653.1 PREDICTED: protein trichome birefringence-like 10... 92 3e-18 KHN19883.1 hypothetical protein glysoja_033515 [Glycine soja] 92 3e-18 XP_003553456.2 PREDICTED: protein trichome birefringence-like 10... 92 3e-18 XP_006576890.1 PREDICTED: protein trichome birefringence-like 10... 92 3e-18 OAY49687.1 hypothetical protein MANES_05G075200 [Manihot esculenta] 90 4e-18 OMO74305.1 hypothetical protein COLO4_26628 [Corchorus olitorius] 92 4e-18 XP_003520562.2 PREDICTED: protein trichome birefringence-like 10... 92 4e-18 >AGE32506.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32508.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32510.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32612.1 hypothetical protein 816152, partial [Populus euphratica] AGE32613.1 hypothetical protein 816152, partial [Populus euphratica] AGE32614.1 hypothetical protein 816152, partial [Populus euphratica] AGE32615.1 hypothetical protein 816152, partial [Populus euphratica] AGE32616.1 hypothetical protein 816152, partial [Populus euphratica] AGE32617.1 hypothetical protein 816152, partial [Populus euphratica] AGE32618.1 hypothetical protein 816152, partial [Populus euphratica] AGE32619.1 hypothetical protein 816152, partial [Populus euphratica] AGE32620.1 hypothetical protein 816152, partial [Populus euphratica] AGE32621.1 hypothetical protein 816152, partial [Populus euphratica] AGE32622.1 hypothetical protein 816152, partial [Populus euphratica] AGE32623.1 hypothetical protein 816152, partial [Populus euphratica] AGE32624.1 hypothetical protein 816152, partial [Populus euphratica] AGE32625.1 hypothetical protein 816152, partial [Populus euphratica] AGE32626.1 hypothetical protein 816152, partial [Populus euphratica] AGE32627.1 hypothetical protein 816152, partial [Populus euphratica] AGE32628.1 hypothetical protein 816152, partial [Populus euphratica] AGE32629.1 hypothetical protein 816152, partial [Populus euphratica] AGE32630.1 hypothetical protein 816152, partial [Populus euphratica] AGE32631.1 hypothetical protein 816152, partial [Populus euphratica] AGE32632.1 hypothetical protein 816152, partial [Populus euphratica] AGE32633.1 hypothetical protein 816152, partial [Populus euphratica] AGE32634.1 hypothetical protein 816152, partial [Populus euphratica] AGE32635.1 hypothetical protein 816152, partial [Populus euphratica] AGE32636.1 hypothetical protein 816152, partial [Populus euphratica] AGE32637.1 hypothetical protein 816152, partial [Populus euphratica] AGE32638.1 hypothetical protein 816152, partial [Populus euphratica] AGE32639.1 hypothetical protein 816152, partial [Populus euphratica] AGE32640.1 hypothetical protein 816152, partial [Populus euphratica] AGE32641.1 hypothetical protein 816152, partial [Populus euphratica] AGE32642.1 hypothetical protein 816152, partial [Populus euphratica] AGE32643.1 hypothetical protein 816152, partial [Populus euphratica] AGE32644.1 hypothetical protein 816152, partial [Populus euphratica] AGE32645.1 hypothetical protein 816152, partial [Populus euphratica] AGE32646.1 hypothetical protein 816152, partial [Populus euphratica] AGE32647.1 hypothetical protein 816152, partial [Populus euphratica] AGE32648.1 hypothetical protein 816152, partial [Populus euphratica] AGE32649.1 hypothetical protein 816152, partial [Populus euphratica] AGE32650.1 hypothetical protein 816152, partial [Populus euphratica] AGE32651.1 hypothetical protein 816152, partial [Populus euphratica] AGE32652.1 hypothetical protein 816152, partial [Populus euphratica] AGE32653.1 hypothetical protein 816152, partial [Populus euphratica] AGE32654.1 hypothetical protein 816152, partial [Populus euphratica] AGE32655.1 hypothetical protein 816152, partial [Populus euphratica] AQM54219.1 hypothetical protein 816152, partial [Populus euphratica] AQM54220.1 hypothetical protein 816152, partial [Populus euphratica] AQM54221.1 hypothetical protein 816152, partial [Populus euphratica] AQM54222.1 hypothetical protein 816152, partial [Populus euphratica] AQM54223.1 hypothetical protein 816152, partial [Populus euphratica] AQM54224.1 hypothetical protein 816152, partial [Populus euphratica] AQM54225.1 hypothetical protein 816152, partial [Populus euphratica] AQM54226.1 hypothetical protein 816152, partial [Populus euphratica] AQM54227.1 hypothetical protein 816152, partial [Populus euphratica] AQM54228.1 hypothetical protein 816152, partial [Populus euphratica] AQM54229.1 hypothetical protein 816152, partial [Populus euphratica] AQM54230.1 hypothetical protein 816152, partial [Populus euphratica] AQM54231.1 hypothetical protein 816152, partial [Populus euphratica] AQM54232.1 hypothetical protein 816152, partial [Populus euphratica] AQM54233.1 hypothetical protein 816152, partial [Populus euphratica] AQM54234.1 hypothetical protein 816152, partial [Populus euphratica] AQM54235.1 hypothetical protein 816152, partial [Populus euphratica] AQM54236.1 hypothetical protein 816152, partial [Populus euphratica] AQM54237.1 hypothetical protein 816152, partial [Populus euphratica] AQM54238.1 hypothetical protein 816152, partial [Populus euphratica] AQM54239.1 hypothetical protein 816152, partial [Populus euphratica] AQM54240.1 hypothetical protein 816152, partial [Populus euphratica] AQM54241.1 hypothetical protein 816152, partial [Populus euphratica] AQM54242.1 hypothetical protein 816152, partial [Populus euphratica] AQM54243.1 hypothetical protein 816152, partial [Populus euphratica] AQM54244.1 hypothetical protein 816152, partial [Populus euphratica] AQM54245.1 hypothetical protein 816152, partial [Populus euphratica] AQM54246.1 hypothetical protein 816152, partial [Populus euphratica] AQM54247.1 hypothetical protein 816152, partial [Populus euphratica] AQM54248.1 hypothetical protein 816152, partial [Populus euphratica] AQM54249.1 hypothetical protein 816152, partial [Populus euphratica] AQM54250.1 hypothetical protein 816152, partial [Populus euphratica] AQM54251.1 hypothetical protein 816152, partial [Populus euphratica] AQM54252.1 hypothetical protein 816152, partial [Populus euphratica] AQM54253.1 hypothetical protein 816152, partial [Populus euphratica] AQM54255.1 hypothetical protein 816152, partial [Populus euphratica] AQM54256.1 hypothetical protein 816152, partial [Populus euphratica] AQM54257.1 hypothetical protein 816152, partial [Populus euphratica] AQM54258.1 hypothetical protein 816152, partial [Populus euphratica] AQM54259.1 hypothetical protein 816152, partial [Populus euphratica] AQM54260.1 hypothetical protein 816152, partial [Populus euphratica] AQM54261.1 hypothetical protein 816152, partial [Populus euphratica] Length = 93 Score = 89.0 bits (219), Expect = 1e-19 Identities = 38/53 (71%), Positives = 46/53 (86%), Gaps = 1/53 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVAN-NRQDCSHWCLPGIPDAWNELLFALLL 466 +T M+ +RKDGHASLYYLGPG A+ +RQDCSHWCLPG+PD+WNELL+ LLL Sbjct: 20 VTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLLL 72 >AQM54271.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54273.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54278.1 hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 88.6 bits (218), Expect = 2e-19 Identities = 37/53 (69%), Positives = 46/53 (86%), Gaps = 1/53 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVAN-NRQDCSHWCLPGIPDAWNELLFALLL 466 +T M+ +RKDGHASLYYLGPG A+ +RQDCSHWCLPG+PD+WNELL+ L+L Sbjct: 20 VTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLJL 72 >XP_016200797.1 PREDICTED: protein trichome birefringence-like 11 [Arachis ipaensis] Length = 159 Score = 90.5 bits (223), Expect = 2e-19 Identities = 38/53 (71%), Positives = 46/53 (86%), Gaps = 1/53 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGP-GNTVANNRQDCSHWCLPGIPDAWNELLFALLL 466 ITEMT +RKDGH+S+YYLGP G T A +RQDCSHWCLPG+PD WNELL+A+ + Sbjct: 101 ITEMTAQRKDGHSSIYYLGPNGGTAALHRQDCSHWCLPGVPDTWNELLYAMFM 153 >XP_015960795.1 PREDICTED: protein trichome birefringence-like 11 [Arachis duranensis] Length = 159 Score = 90.5 bits (223), Expect = 2e-19 Identities = 38/53 (71%), Positives = 46/53 (86%), Gaps = 1/53 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGP-GNTVANNRQDCSHWCLPGIPDAWNELLFALLL 466 ITEMT +RKDGH+S+YYLGP G T A +RQDCSHWCLPG+PD WNELL+A+ + Sbjct: 101 ITEMTAQRKDGHSSIYYLGPNGGTAALHRQDCSHWCLPGVPDTWNELLYAMFM 153 >AGE32507.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32509.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32511.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32512.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32513.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32514.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32515.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32516.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32517.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32518.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32519.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32520.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32521.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32522.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32523.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32524.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32525.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32526.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32527.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32528.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32529.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32530.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32531.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32532.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32533.1 hypothetical protein 816152, partial [Populus pruinosa] AGE32610.1 hypothetical protein 816152, partial [Populus euphratica] AGE32611.1 hypothetical protein 816152, partial [Populus euphratica] AQM54254.1 hypothetical protein 816152, partial [Populus euphratica] AQM54262.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54263.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54264.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54266.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54268.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54269.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54270.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54272.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54274.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54275.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54276.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54277.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54279.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54280.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54281.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54282.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54283.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54284.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54285.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54286.1 hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 88.2 bits (217), Expect = 2e-19 Identities = 37/53 (69%), Positives = 46/53 (86%), Gaps = 1/53 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVAN-NRQDCSHWCLPGIPDAWNELLFALLL 466 +T M+ +RKDGHASLYYLGPG A+ +RQDCSHWCLPG+PD+WNELL+ L+L Sbjct: 20 VTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLIL 72 >XP_019444493.1 PREDICTED: protein trichome birefringence-like 10 isoform X2 [Lupinus angustifolius] XP_019444494.1 PREDICTED: protein trichome birefringence-like 10 isoform X2 [Lupinus angustifolius] OIW11285.1 hypothetical protein TanjilG_28376 [Lupinus angustifolius] Length = 449 Score = 95.1 bits (235), Expect = 2e-19 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +TEM+ +RKDGHAS+YY+GP T A RQDCSHWCLPG+PD+WNE+L+ALLL R Sbjct: 382 VTEMSLRRKDGHASIYYVGPNRTAAMTRQDCSHWCLPGVPDSWNEILYALLLKR 435 >XP_019444492.1 PREDICTED: protein trichome birefringence-like 10 isoform X1 [Lupinus angustifolius] Length = 451 Score = 95.1 bits (235), Expect = 2e-19 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +TEM+ +RKDGHAS+YY+GP T A RQDCSHWCLPG+PD+WNE+L+ALLL R Sbjct: 382 VTEMSLRRKDGHASIYYVGPNRTAAMTRQDCSHWCLPGVPDSWNEILYALLLKR 435 >AQM54265.1 hypothetical protein 816152, partial [Populus pruinosa] AQM54267.1 hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 86.7 bits (213), Expect = 9e-19 Identities = 36/52 (69%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVAN-NRQDCSHWCLPGIPDAWNELLFALL 469 +T M+ +RKDGHASLYYLGPG A+ +RQDCSHWCLPG+PD+WNELL+ L+ Sbjct: 20 VTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLI 71 >XP_014496188.1 PREDICTED: protein trichome birefringence-like 10 [Vigna radiata var. radiata] Length = 462 Score = 92.4 bits (228), Expect = 2e-18 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +T+M+ +R+DGHAS+YYLGP T RQDCSHWCLPG+PD+WNELL+ALLL R Sbjct: 391 VTQMSIRRRDGHASIYYLGPDGTAPMQRQDCSHWCLPGVPDSWNELLYALLLKR 444 >KOM30111.1 hypothetical protein LR48_Vigan902s000800 [Vigna angularis] Length = 462 Score = 92.4 bits (228), Expect = 2e-18 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +T+M+ +R+DGHAS+YYLGP T RQDCSHWCLPG+PD+WNELL+ALLL R Sbjct: 391 VTQMSIRRRDGHASIYYLGPDGTAPMQRQDCSHWCLPGVPDSWNELLYALLLKR 444 >KYP43217.1 hypothetical protein KK1_035358 [Cajanus cajan] Length = 468 Score = 92.4 bits (228), Expect = 2e-18 Identities = 36/54 (66%), Positives = 47/54 (87%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +T+M+ +R+DGHAS+YYLGP T + RQDCSHWCLPG+PD+WNE+L+ALLL R Sbjct: 397 VTKMSMRRRDGHASIYYLGPDGTASMQRQDCSHWCLPGVPDSWNEMLYALLLKR 450 >XP_017411061.1 PREDICTED: protein trichome birefringence-like 10 [Vigna angularis] BAT85429.1 hypothetical protein VIGAN_04297700 [Vigna angularis var. angularis] Length = 472 Score = 92.4 bits (228), Expect = 2e-18 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +T+M+ +R+DGHAS+YYLGP T RQDCSHWCLPG+PD+WNELL+ALLL R Sbjct: 401 VTQMSIRRRDGHASIYYLGPDGTAPMQRQDCSHWCLPGVPDSWNELLYALLLKR 454 >XP_007162412.1 hypothetical protein PHAVU_001G150000g [Phaseolus vulgaris] ESW34406.1 hypothetical protein PHAVU_001G150000g [Phaseolus vulgaris] Length = 473 Score = 92.4 bits (228), Expect = 2e-18 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +T+M+ +R+DGHAS+YYLGP T RQDCSHWCLPG+PD+WNELL+ALLL R Sbjct: 402 VTQMSIRRRDGHASIYYLGPDGTAPMQRQDCSHWCLPGVPDSWNELLYALLLKR 455 >XP_015958653.1 PREDICTED: protein trichome birefringence-like 10 [Arachis duranensis] Length = 427 Score = 92.0 bits (227), Expect = 3e-18 Identities = 39/53 (73%), Positives = 47/53 (88%), Gaps = 1/53 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGP-GNTVANNRQDCSHWCLPGIPDAWNELLFALLL 466 ITEMT +RKDGH+S+YYLGP G T A +RQDCSHWCLPG+PD WNELL+A+L+ Sbjct: 369 ITEMTAQRKDGHSSIYYLGPNGGTAALHRQDCSHWCLPGVPDTWNELLYAMLM 421 >KHN19883.1 hypothetical protein glysoja_033515 [Glycine soja] Length = 410 Score = 91.7 bits (226), Expect = 3e-18 Identities = 34/52 (65%), Positives = 47/52 (90%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLL 466 +T+M+ +R+DGHAS+YY+GP +T + RQDCSHWCLPG+PD+WNE+L+ALLL Sbjct: 339 VTQMSQRRRDGHASIYYIGPDSTASMQRQDCSHWCLPGVPDSWNEILYALLL 390 >XP_003553456.2 PREDICTED: protein trichome birefringence-like 10 isoform X1 [Glycine max] KHN45363.1 hypothetical protein glysoja_028370 [Glycine soja] KRG95503.1 hypothetical protein GLYMA_19G154900 [Glycine max] KRG95504.1 hypothetical protein GLYMA_19G154900 [Glycine max] Length = 472 Score = 92.0 bits (227), Expect = 3e-18 Identities = 35/54 (64%), Positives = 48/54 (88%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLLHR 460 +T+M+ +R+DGHAS+YY+GP +T + RQDCSHWCLPG+PD+WNE+L+ALLL R Sbjct: 401 VTQMSIRRRDGHASIYYIGPDSTASMQRQDCSHWCLPGVPDSWNEILYALLLKR 454 >XP_006576890.1 PREDICTED: protein trichome birefringence-like 10 isoform X2 [Glycine max] KRH67184.1 hypothetical protein GLYMA_03G152400 [Glycine max] Length = 417 Score = 91.7 bits (226), Expect = 3e-18 Identities = 34/52 (65%), Positives = 47/52 (90%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLL 466 +T+M+ +R+DGHAS+YY+GP +T + RQDCSHWCLPG+PD+WNE+L+ALLL Sbjct: 346 VTQMSQRRRDGHASIYYIGPDSTASMQRQDCSHWCLPGVPDSWNEILYALLL 397 >OAY49687.1 hypothetical protein MANES_05G075200 [Manihot esculenta] Length = 301 Score = 90.1 bits (222), Expect = 4e-18 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVAN-NRQDCSHWCLPGIPDAWNELLFALLLHRVNRTA 445 +T MT +RKDGHASLYYL PG A+ NRQDCSHWCLPG+PD+WNELL+A LL R + A Sbjct: 231 VTHMTAQRKDGHASLYYLEPGIGPASLNRQDCSHWCLPGVPDSWNELLYAFLLKRDSVHA 290 Query: 444 GYST 433 ST Sbjct: 291 QSST 294 >OMO74305.1 hypothetical protein COLO4_26628 [Corchorus olitorius] Length = 457 Score = 91.7 bits (226), Expect = 4e-18 Identities = 42/70 (60%), Positives = 53/70 (75%), Gaps = 2/70 (2%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVAN-NRQDCSHWCLPGIPDAWNELLFALLL-HRVNRT 448 +T MT +RKDGH+SLYYLGP + A +RQDCSHWCLPG+PDAWNELL+AL L H ++ T Sbjct: 388 VTRMTAERKDGHSSLYYLGPKESPAPLHRQDCSHWCLPGVPDAWNELLYALFLKHHIHHT 447 Query: 447 AGYSTLRQKV 418 ST ++ Sbjct: 448 FNSSTYEAQI 457 >XP_003520562.2 PREDICTED: protein trichome birefringence-like 10 isoform X1 [Glycine max] KRH67183.1 hypothetical protein GLYMA_03G152400 [Glycine max] Length = 470 Score = 91.7 bits (226), Expect = 4e-18 Identities = 34/52 (65%), Positives = 47/52 (90%) Frame = -1 Query: 621 ITEMTNKRKDGHASLYYLGPGNTVANNRQDCSHWCLPGIPDAWNELLFALLL 466 +T+M+ +R+DGHAS+YY+GP +T + RQDCSHWCLPG+PD+WNE+L+ALLL Sbjct: 399 VTQMSQRRRDGHASIYYIGPDSTASMQRQDCSHWCLPGVPDSWNEILYALLL 450