BLASTX nr result
ID: Alisma22_contig00026393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00026393 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009403599.1 PREDICTED: F-box protein At1g67340-like [Musa acu... 54 7e-06 >XP_009403599.1 PREDICTED: F-box protein At1g67340-like [Musa acuminata subsp. malaccensis] Length = 385 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/67 (44%), Positives = 38/67 (56%), Gaps = 8/67 (11%) Frame = +2 Query: 182 GSGRKRKRQQMASEVDEDRTCRQMRF--------DFFDDLPEEMIVTILSKLSTTATRPA 337 G RKR R+ A D R M DFFD LP+E++V+IL KLS +A RPA Sbjct: 26 GRRRKRSRRVPAGGAAADEPARMMASEGVAGEMPDFFDSLPDELVVSILCKLSASAARPA 85 Query: 338 DLLNVRL 358 DL+ VR+ Sbjct: 86 DLVGVRI 92