BLASTX nr result
ID: Alisma22_contig00025921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00025921 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011099280.1 PREDICTED: elongation of fatty acids protein 3-li... 49 2e-06 EYU44307.1 hypothetical protein MIMGU_mgv1a010872mg [Erythranthe... 49 5e-06 XP_012852600.1 PREDICTED: elongation of fatty acids protein 3-li... 49 5e-06 XP_019438008.1 PREDICTED: elongation of fatty acids protein 3-li... 47 5e-06 KZV15092.1 hypothetical protein F511_34928 [Dorcoceras hygrometr... 49 7e-06 XP_015884582.1 PREDICTED: elongation of fatty acids protein 3-li... 52 9e-06 >XP_011099280.1 PREDICTED: elongation of fatty acids protein 3-like [Sesamum indicum] Length = 300 Score = 49.3 bits (116), Expect(2) = 2e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = -3 Query: 298 LSSAAEICDTRWL*RGTGTTAFHWLLCFPARVSPSHTPPSWS 173 LS+ AEI DTRWL R + TT F WLLCFP PS WS Sbjct: 89 LSATAEIRDTRWLWRRSRTTTFQWLLCFPLGTRPSGRVFFWS 130 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = -2 Query: 191 HSTLVVVWFLY----RIFRVMAIPLTMLV---INGYKFW 96 HS L+ + FL+ + F+V+AI LT LV + GY+FW Sbjct: 162 HSILIFMSFLWLEFSQSFQVLAILLTTLVYSVVYGYRFW 200 >EYU44307.1 hypothetical protein MIMGU_mgv1a010872mg [Erythranthe guttata] Length = 299 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -3 Query: 298 LSSAAEICDTRWL*RGTGTTAFHWLLCFPARVSPSHTPPSWS 173 LS+AAEI D+RWL R + TT F WLLCFP PS WS Sbjct: 89 LSAAAEIRDSRWLWRRSRTTPFQWLLCFPLGTRPSGRVFFWS 130 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = -2 Query: 191 HSTLVVVWFLY----RIFRVMAIPLTMLV---INGYKFW 96 HS ++ + FL+ + F+V+AI LT LV + GY+FW Sbjct: 162 HSIMIFMSFLWLEFSQSFQVLAILLTTLVYSVVYGYRFW 200 >XP_012852600.1 PREDICTED: elongation of fatty acids protein 3-like [Erythranthe guttata] Length = 296 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -3 Query: 298 LSSAAEICDTRWL*RGTGTTAFHWLLCFPARVSPSHTPPSWS 173 LS+AAEI D+RWL R + TT F WLLCFP PS WS Sbjct: 89 LSAAAEIRDSRWLWRRSRTTPFQWLLCFPLGTRPSGRVFFWS 130 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = -2 Query: 191 HSTLVVVWFLY----RIFRVMAIPLTMLV---INGYKFW 96 HS ++ + FL+ + F+V+AI LT LV + GY+FW Sbjct: 162 HSIMIFMSFLWLEFSQSFQVLAILLTTLVYSVVYGYRFW 200 >XP_019438008.1 PREDICTED: elongation of fatty acids protein 3-like [Lupinus angustifolius] Length = 290 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -3 Query: 295 SSAAEICDTRWL*RGTGTTAFHWLLCFPARVSPSHTPPSWS 173 S+ AE+ DTRWL + T TT+F W LCFP + PS WS Sbjct: 91 SADAEVRDTRWLWQRTRTTSFEWFLCFPLGIRPSGRVFFWS 131 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 7/47 (14%) Frame = -2 Query: 191 HSTLVVVWFLY----RIFRVMAIPLTMLV---INGYKFWIDLSWVSY 72 HS L+++ FL+ + F+V+AI + L+ + GY+FW+++ +Y Sbjct: 163 HSILLIMSFLWLEFSQSFQVLAILFSTLIYTMVYGYRFWVEMGLPTY 209 >KZV15092.1 hypothetical protein F511_34928 [Dorcoceras hygrometricum] Length = 298 Score = 49.3 bits (116), Expect(2) = 7e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -3 Query: 298 LSSAAEICDTRWL*RGTGTTAFHWLLCFPARVSPSHTPPSWS 173 LSSAAEI DTRW R + TT F WLLCFP PS WS Sbjct: 89 LSSAAEIRDTRWSWRRSRTTPFQWLLCFPLGTRPSGRVFFWS 130 Score = 27.7 bits (60), Expect(2) = 7e-06 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 7/42 (16%) Frame = -2 Query: 191 HSTLVVVWFLY----RIFRVMAIPLTMLV---INGYKFWIDL 87 +S L+ + FL+ + F+V+AI LT LV + GY+FW ++ Sbjct: 162 NSILIFMSFLWLEFSQSFQVLAILLTTLVYSVVYGYRFWTEI 203 >XP_015884582.1 PREDICTED: elongation of fatty acids protein 3-like [Ziziphus jujuba] Length = 313 Score = 52.4 bits (124), Expect = 9e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -3 Query: 298 LSSAAEICDTRWL*RGTGTTAFHWLLCFPARVSPSHTPPSWS 173 LS+AAEI DTRW R T TT F WLLCFP + PS WS Sbjct: 92 LSAAAEIQDTRWFLRRTNTTPFQWLLCFPRGIRPSGRVFFWS 133