BLASTX nr result
ID: Alisma22_contig00025857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00025857 (740 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001151698.1 RNA binding protein [Zea mays] ACG44013.1 RNA bin... 57 5e-06 OEL14635.1 U11/U12 small nuclear ribonucleoprotein 31 kDa protei... 57 5e-06 XP_008789535.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 56 8e-06 >NP_001151698.1 RNA binding protein [Zea mays] ACG44013.1 RNA binding protein [Zea mays] Length = 267 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 45 WASVVDTRGLEEKMSRRGDEPVEKARKVKKAGYFSDESEEDD 170 WASVVDTRG+EEK + +G+ V+ AR+ K+ YFSDES+EDD Sbjct: 225 WASVVDTRGVEEKAAGKGEGMVKAARREKRKCYFSDESDEDD 266 >OEL14635.1 U11/U12 small nuclear ribonucleoprotein 31 kDa protein [Dichanthelium oligosanthes] Length = 268 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 45 WASVVDTRGLEEKMSRRGDEPVEKARKVKKAGYFSDESEEDD 170 WASVVDTRG EEK + + D + ARK K+ GYFSDES+EDD Sbjct: 226 WASVVDTRGDEEKAAGKEDGKAKAARKEKRKGYFSDESDEDD 267 >XP_008789535.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 31 kDa protein [Phoenix dactylifera] XP_008789536.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 31 kDa protein [Phoenix dactylifera] Length = 258 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +3 Query: 42 NWASVVDTRGLEEKMSRRG---DEPVEKARKVKKAGYFSDESEEDD 170 NWAS+VDTRG EEK R D+ ++ +K KKAGYFSDES EDD Sbjct: 213 NWASIVDTRGAEEKARGREEWRDDGKDRKKKAKKAGYFSDESGEDD 258