BLASTX nr result
ID: Alisma22_contig00025681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00025681 (614 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016197044.1 PREDICTED: LYR motif-containing protein At3g19508... 112 8e-29 XP_016197041.1 PREDICTED: LYR motif-containing protein At3g19508... 112 1e-28 XP_008456173.1 PREDICTED: LYR motif-containing protein At3g19508... 111 2e-28 XP_016197040.1 PREDICTED: LYR motif-containing protein At3g19508... 112 2e-28 XP_016197039.1 PREDICTED: LYR motif-containing protein At3g19508... 112 3e-28 XP_004511298.1 PREDICTED: LYR motif-containing protein At3g19508... 110 3e-28 XP_009758975.1 PREDICTED: LYR motif-containing protein At3g19508... 110 4e-28 XP_015958458.1 PREDICTED: LYR motif-containing protein At3g19508... 110 5e-28 XP_016465348.1 PREDICTED: LYR motif-containing protein At3g19508... 110 5e-28 XP_015892821.1 PREDICTED: LYR motif-containing protein At3g19508... 109 6e-28 XP_013453298.1 UPF0631 plant-like protein [Medicago truncatula] ... 109 6e-28 XP_015958457.1 PREDICTED: LYR motif-containing protein At3g19508... 110 6e-28 XP_015958456.1 PREDICTED: LYR motif-containing protein At3g19508... 110 1e-27 XP_015958455.1 PREDICTED: LYR motif-containing protein At3g19508... 110 2e-27 GAU29522.1 hypothetical protein TSUD_115440 [Trifolium subterran... 108 2e-27 XP_010028401.1 PREDICTED: LYR motif-containing protein At3g19508... 108 2e-27 XP_004140718.1 PREDICTED: LYR motif-containing protein At3g19508... 108 2e-27 XP_006422896.1 hypothetical protein CICLE_v10029710mg [Citrus cl... 108 2e-27 XP_016539488.1 PREDICTED: LYR motif-containing protein At3g19508... 107 4e-27 XP_006346350.1 PREDICTED: LYR motif-containing protein At3g19508... 107 6e-27 >XP_016197044.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X4 [Arachis ipaensis] Length = 84 Score = 112 bits (279), Expect = 8e-29 Identities = 52/78 (66%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD +D+ L ++F+R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPSDSTTLHDLFQRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYSVD ADKL+ IC Sbjct: 63 LHKYSVDDSAADKLKRIC 80 >XP_016197041.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X3 [Arachis ipaensis] Length = 96 Score = 112 bits (279), Expect = 1e-28 Identities = 52/78 (66%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD +D+ L ++F+R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPSDSTTLHDLFQRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYSVD ADKL+ IC Sbjct: 63 LHKYSVDDSAADKLKRIC 80 >XP_008456173.1 PREDICTED: LYR motif-containing protein At3g19508 [Cucumis melo] Length = 82 Score = 111 bits (277), Expect = 2e-28 Identities = 54/78 (69%), Positives = 61/78 (78%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +R Y EVLRLVRRLP +TR YYAKYARENFVNYR+ DA LEE+F RAYN S+WV Sbjct: 3 KALRVYGEVLRLVRRLPKDTRPYYAKYARENFVNYREVDANDAKSLEELFHRAYNHSLWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KYSVD ADKL+ IC Sbjct: 63 LNKYSVDGSAADKLKEIC 80 >XP_016197040.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Arachis ipaensis] Length = 121 Score = 112 bits (279), Expect = 2e-28 Identities = 52/78 (66%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD +D+ L ++F+R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPSDSTTLHDLFQRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYSVD ADKL+ IC Sbjct: 63 LHKYSVDDSAADKLKRIC 80 >XP_016197039.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X1 [Arachis ipaensis] Length = 129 Score = 112 bits (279), Expect = 3e-28 Identities = 52/78 (66%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD +D+ L ++F+R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPSDSTTLHDLFQRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYSVD ADKL+ IC Sbjct: 63 LHKYSVDDSAADKLKRIC 80 >XP_004511298.1 PREDICTED: LYR motif-containing protein At3g19508 [Cicer arietinum] Length = 82 Score = 110 bits (275), Expect = 3e-28 Identities = 51/78 (65%), Positives = 61/78 (78%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K VRAY EVLRLVRRLP ++RGYYAKYARENFVNYR+ +D+ L ++F+R Y S+WV Sbjct: 3 KAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSDSSTLHDLFQRTYTHSLWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYSVD ADKL+ IC Sbjct: 63 LHKYSVDESAADKLKGIC 80 >XP_009758975.1 PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana sylvestris] Length = 87 Score = 110 bits (275), Expect = 4e-28 Identities = 51/78 (65%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K + AYREVLRLVRRLP +TR YYAKYARENFVNYR+ D L+E+ +RAYN S+WV Sbjct: 8 KAIGAYREVLRLVRRLPKDTRPYYAKYARENFVNYREIDSNDPNALQELLQRAYNHSIWV 67 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KYSVD+ AD+L+ IC Sbjct: 68 LNKYSVDQSTADRLKIIC 85 >XP_015958458.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X4 [Arachis duranensis] Length = 84 Score = 110 bits (274), Expect = 5e-28 Identities = 51/78 (65%), Positives = 60/78 (76%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD D+ L ++F R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPFDSTTLHDLFHRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYS+D ADKL+ IC Sbjct: 63 LHKYSIDDSAADKLKRIC 80 >XP_016465348.1 PREDICTED: LYR motif-containing protein At3g19508-like [Nicotiana tabacum] Length = 87 Score = 110 bits (274), Expect = 5e-28 Identities = 51/78 (65%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K + AYREVLRLVRRLP +TR YYAKYARENFVNYR+ D L+E+ +RAYN S+WV Sbjct: 8 KAIGAYREVLRLVRRLPKDTRPYYAKYARENFVNYREIDSNDPNALQELLQRAYNHSIWV 67 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KYSVD+ AD+L+ IC Sbjct: 68 LNKYSVDQSAADRLKIIC 85 >XP_015892821.1 PREDICTED: LYR motif-containing protein At3g19508 [Ziziphus jujuba] Length = 82 Score = 109 bits (273), Expect = 6e-28 Identities = 51/78 (65%), Positives = 62/78 (79%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +R Y E+LRLVRRLP +TR YYAKYARENFVNYR+ D+ LEE+F RAYN S+WV Sbjct: 3 KALRIYGEILRLVRRLPKDTRPYYAKYARENFVNYREVDANDSIALEELFHRAYNHSIWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KYSVD+ ADKL+ +C Sbjct: 63 LNKYSVDQSAADKLKEVC 80 >XP_013453298.1 UPF0631 plant-like protein [Medicago truncatula] KEH27327.1 UPF0631 plant-like protein [Medicago truncatula] Length = 83 Score = 109 bits (273), Expect = 6e-28 Identities = 51/78 (65%), Positives = 61/78 (78%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K VRAY EVLRLVRRLP ++RGYYAKYARENFVNYR+ +D+ L ++F+R Y S+WV Sbjct: 3 KAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSDSTTLHDLFQRTYTHSLWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYSVD ADKL+ IC Sbjct: 63 LHKYSVDESVADKLKVIC 80 >XP_015958457.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X3 [Arachis duranensis] Length = 96 Score = 110 bits (274), Expect = 6e-28 Identities = 51/78 (65%), Positives = 60/78 (76%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD D+ L ++F R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPFDSTTLHDLFHRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYS+D ADKL+ IC Sbjct: 63 LHKYSIDDSAADKLKRIC 80 >XP_015958456.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Arachis duranensis] Length = 112 Score = 110 bits (274), Expect = 1e-27 Identities = 51/78 (65%), Positives = 60/78 (76%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD D+ L ++F R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPFDSTTLHDLFHRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYS+D ADKL+ IC Sbjct: 63 LHKYSIDDSAADKLKRIC 80 >XP_015958455.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X1 [Arachis duranensis] Length = 129 Score = 110 bits (274), Expect = 2e-27 Identities = 51/78 (65%), Positives = 60/78 (76%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY EVLRLVRRLP E+RGYYAKYARENFVNYRD D+ L ++F R YN S+W+ Sbjct: 3 KALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPFDSTTLHDLFHRTYNHSIWL 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYS+D ADKL+ IC Sbjct: 63 LHKYSIDDSAADKLKRIC 80 >GAU29522.1 hypothetical protein TSUD_115440 [Trifolium subterraneum] Length = 82 Score = 108 bits (270), Expect = 2e-27 Identities = 50/78 (64%), Positives = 61/78 (78%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K VRAY EVLRLVRRLP ++RGYYAKYARENFVNYR+ +D+ L ++F+R Y S+WV Sbjct: 3 KAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSDSTTLHDLFQRTYTHSLWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L KYS+D ADKL+ IC Sbjct: 63 LHKYSIDGSAADKLKGIC 80 >XP_010028401.1 PREDICTED: LYR motif-containing protein At3g19508 [Eucalyptus grandis] KCW55144.1 hypothetical protein EUGRSUZ_I01095 [Eucalyptus grandis] Length = 82 Score = 108 bits (270), Expect = 2e-27 Identities = 51/78 (65%), Positives = 61/78 (78%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +R Y EVLRLVRRLP ++R YYAKYARENFVNYRDA AD L+E+F RAYN S+WV Sbjct: 3 KALRVYGEVLRLVRRLPKDSRPYYAKYARENFVNYRDADAADPSALDELFHRAYNHSIWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KYSV+ A +L+ IC Sbjct: 63 LNKYSVEESAAHRLKEIC 80 >XP_004140718.1 PREDICTED: LYR motif-containing protein At3g19508 [Cucumis sativus] KGN57494.1 hypothetical protein Csa_3G199560 [Cucumis sativus] Length = 82 Score = 108 bits (270), Expect = 2e-27 Identities = 52/78 (66%), Positives = 60/78 (76%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +R Y EVLRLVR+LP +TR YYAKY RENFVNYR+ DA LEE+F RAYN S+WV Sbjct: 3 KALRVYGEVLRLVRQLPKDTRPYYAKYVRENFVNYREVDAQDAKSLEELFHRAYNHSLWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KYSVD ADKL+ IC Sbjct: 63 LNKYSVDGSAADKLKEIC 80 >XP_006422896.1 hypothetical protein CICLE_v10029710mg [Citrus clementina] XP_006486975.1 PREDICTED: LYR motif-containing protein At3g19508 [Citrus sinensis] ESR36136.1 hypothetical protein CICLE_v10029710mg [Citrus clementina] Length = 82 Score = 108 bits (269), Expect = 2e-27 Identities = 50/78 (64%), Positives = 60/78 (76%) Frame = -1 Query: 509 KGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSVWV 330 K +RAY VLRL+RRLP +TR YYAKYARENFVNYR+ DA L+E+F RAYN S+WV Sbjct: 3 KALRAYATVLRLIRRLPKDTRPYYAKYARENFVNYREVDANDASSLDELFHRAYNHSIWV 62 Query: 329 LDKYSVDRKWADKLEAIC 276 L+KY V+ ADKL+ IC Sbjct: 63 LNKYKVEESAADKLKDIC 80 >XP_016539488.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] XP_016539489.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] XP_016539490.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] XP_016539491.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] Length = 87 Score = 107 bits (268), Expect = 4e-27 Identities = 50/80 (62%), Positives = 61/80 (76%) Frame = -1 Query: 515 IMKGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSV 336 + K + AYREVLRLVRRLP +TR YYAKYARENFVNYR+ D L+E+ +R YN S+ Sbjct: 6 MQKAIGAYREVLRLVRRLPKDTRPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHSI 65 Query: 335 WVLDKYSVDRKWADKLEAIC 276 WVL KYSVD+ AD+L+ IC Sbjct: 66 WVLKKYSVDQSAADRLKNIC 85 >XP_006346350.1 PREDICTED: LYR motif-containing protein At3g19508 [Solanum tuberosum] Length = 87 Score = 107 bits (267), Expect = 6e-27 Identities = 50/82 (60%), Positives = 62/82 (75%) Frame = -1 Query: 515 IMKGVRAYREVLRLVRRLPNETRGYYAKYARENFVNYRDATDADAGELEEVFRRAYNQSV 336 + K + AYREVLRLVRRLP ++R YYAKYARENFVNYR+ D L+E+ +R YN S+ Sbjct: 6 MQKAIGAYREVLRLVRRLPKDSRPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHSL 65 Query: 335 WVLDKYSVDRKWADKLEAICRD 270 WVL KYSVD+ AD+L+ IC D Sbjct: 66 WVLKKYSVDQSAADRLKNICSD 87