BLASTX nr result
ID: Alisma22_contig00025641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00025641 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018625409.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 56 1e-07 XP_018625408.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 56 1e-07 NP_001313179.1 2-alkenal reductase (NADP(+)-dependent) [Nicotian... 55 3e-07 XP_009597549.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 55 3e-07 4HFJ_A Chain A, X-ray Crystal Structure Of A Double Bond Reducta... 55 3e-07 XP_016541610.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 54 8e-07 XP_019247227.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 53 2e-06 XP_016507936.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 53 2e-06 XP_009782873.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 53 2e-06 XP_007202267.1 hypothetical protein PRUPE_ppa007810mg [Prunus pe... 53 2e-06 XP_008367739.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 53 2e-06 XP_009343692.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 52 4e-06 XP_004287171.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 52 5e-06 XP_004287172.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 51 7e-06 XP_017182386.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 51 9e-06 >XP_018625409.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X3 [Nicotiana tomentosiformis] Length = 286 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 49 QVIPCWAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 Q I + V KV+ESGDPKFQKGD+V+G GWEEYS+I P+ + Sbjct: 18 QPITGYGVAKVLESGDPKFQKGDLVWGMT-GWEEYSIITPTQT 59 >XP_018625408.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X2 [Nicotiana tomentosiformis] Length = 308 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 49 QVIPCWAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 Q I + V KV+ESGDPKFQKGD+V+G GWEEYS+I P+ + Sbjct: 40 QPITGYGVAKVLESGDPKFQKGDLVWGMT-GWEEYSIITPTQT 81 >NP_001313179.1 2-alkenal reductase (NADP(+)-dependent) [Nicotiana tabacum] XP_016514079.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Nicotiana tabacum] Q9SLN8.1 RecName: Full=2-alkenal reductase (NADP(+)-dependent); AltName: Full=Alkenal double bound reductase; AltName: Full=Allylic alcohol dehydrogenase 1; Short=allyl-ADH1; AltName: Full=Flavin-free double bond reductase; Short=NtDBR; AltName: Full=Pulegone reductase; Short=NtRed-1 BAA89423.1 allyl alcohol dehydrogenase [Nicotiana tabacum] Length = 343 Score = 55.1 bits (131), Expect = 3e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 + V KV+ESGDPKFQKGD+V+G GWEEYS+I P+ + Sbjct: 80 YGVAKVLESGDPKFQKGDLVWGMT-GWEEYSIITPTQT 116 >XP_009597549.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X1 [Nicotiana tomentosiformis] Length = 343 Score = 55.1 bits (131), Expect = 3e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 + V KV+ESGDPKFQKGD+V+G GWEEYS+I P+ + Sbjct: 80 YGVAKVLESGDPKFQKGDLVWGMT-GWEEYSIITPTQT 116 >4HFJ_A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum 4HFJ_B Chain B, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum 4HFM_A Chain A, X-ray Crystal Structure Of A Nadp(h)-bound Double Bond Reductase From Nicotiana Tabacum 4HFM_B Chain B, X-ray Crystal Structure Of A Nadp(h)-bound Double Bond Reductase From Nicotiana Tabacum 4HFN_A Chain A, X-ray Crystal Structure Of A Ternary Complex Of Double Bond Reductase From Nicotiana Tabacum 4HFN_B Chain B, X-ray Crystal Structure Of A Ternary Complex Of Double Bond Reductase From Nicotiana Tabacum Length = 351 Score = 55.1 bits (131), Expect = 3e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 + V KV+ESGDPKFQKGD+V+G GWEEYS+I P+ + Sbjct: 80 YGVAKVLESGDPKFQKGDLVWGMT-GWEEYSIITPTQT 116 >XP_016541610.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Capsicum annuum] Length = 344 Score = 53.9 bits (128), Expect = 8e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSSSLF 186 + V KV+ESGD F+KGD+V+G GWEEYS++ P+ S+LF Sbjct: 80 YGVAKVLESGDSNFEKGDLVWGMT-GWEEYSIVTPTQSTLF 119 >XP_019247227.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Nicotiana attenuata] OIT02001.1 2-alkenal reductase (nadp(+)-dependent) [Nicotiana attenuata] Length = 343 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSSSLF 186 + V KV+ESGDPKFQKGD+V+G GWEEYS+I S+ +LF Sbjct: 80 YGVAKVLESGDPKFQKGDLVWGMT-GWEEYSII-TSTQTLF 118 >XP_016507936.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nicotiana tabacum] Length = 343 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 + V KV+ESGDP FQKGD+V+G GWEEYS+I P+ + Sbjct: 80 YGVAKVLESGDPNFQKGDLVWGMT-GWEEYSIITPTQT 116 >XP_009782873.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Nicotiana sylvestris] Length = 343 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 + V KV+ESGDP FQKGD+V+G GWEEYS+I P+ + Sbjct: 80 YGVAKVLESGDPNFQKGDLVWGMT-GWEEYSIITPTQT 116 >XP_007202267.1 hypothetical protein PRUPE_ppa007810mg [Prunus persica] ONH98843.1 hypothetical protein PRUPE_7G268600 [Prunus persica] Length = 355 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSSSLFSKI 195 + VGKV+ESGDPKF++GD+V+G+ GWEEYS+I +++ KI Sbjct: 89 YGVGKVLESGDPKFKEGDLVWGTT-GWEEYSLITGTATQSLFKI 131 >XP_008367739.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus domestica] Length = 349 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSSSLF 186 + V KV+ESGDPKF+KGD+++G GWEEYSVI S+ SLF Sbjct: 86 YGVAKVLESGDPKFKKGDLIWGMT-GWEEYSVI-TSTESLF 124 >XP_009343692.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Pyrus x bretschneideri] Length = 224 Score = 51.6 bits (122), Expect = 4e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 64 WAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 + V KV+ESGDPKF+KGD+++G GWEEYSVI + S Sbjct: 86 YGVAKVLESGDPKFKKGDLIWGMT-GWEEYSVITATES 122 >XP_004287171.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Fragaria vesca subsp. vesca] Length = 344 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = +1 Query: 49 QVIPCWAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 Q + + V KV+ESGDPKF+ GD+V+G + GWEEYSVI + S Sbjct: 76 QTVTGYGVAKVLESGDPKFKPGDLVWG-HTGWEEYSVITATES 117 >XP_004287172.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Fragaria vesca subsp. vesca] Length = 347 Score = 51.2 bits (121), Expect = 7e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +1 Query: 49 QVIPCWAVGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 Q + + V KV+ESGDPKF+ GD+V+G GWEEYSVI + S Sbjct: 79 QTVTGYGVAKVLESGDPKFKPGDLVWGPT-GWEEYSVITATES 120 >XP_017182386.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus domestica] Length = 273 Score = 50.8 bits (120), Expect = 9e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +1 Query: 70 VGKVVESGDPKFQKGDIVYGSNMGWEEYSVIDPSSS 177 V KV+ESGDPKF+KGD+++G GWEEYSVI + S Sbjct: 12 VAKVLESGDPKFKKGDLIWGMT-GWEEYSVITATES 46