BLASTX nr result
ID: Alisma22_contig00025614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00025614 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT63903.1 Abscisic stress-ripening protein 1, partial [Anthuriu... 50 6e-06 JAT61329.1 Abscisic stress-ripening protein 1 [Anthurium amnicola] 50 6e-06 >JAT63903.1 Abscisic stress-ripening protein 1, partial [Anthurium amnicola] Length = 122 Score = 50.4 bits (119), Expect = 6e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -3 Query: 257 KDPENAHKHRIRQEVSTAVSVGSGVFALHER 165 KDPENAH+H++ +EV+ AV+VGSG +A HER Sbjct: 70 KDPENAHRHKVEEEVAAAVAVGSGGYAFHER 100 >JAT61329.1 Abscisic stress-ripening protein 1 [Anthurium amnicola] Length = 123 Score = 50.4 bits (119), Expect = 6e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -3 Query: 257 KDPENAHKHRIRQEVSTAVSVGSGVFALHER 165 KDPENAH+H++ +EV+ AV+VGSG +A HER Sbjct: 72 KDPENAHRHKVEEEVAAAVAVGSGGYAFHER 102