BLASTX nr result
ID: Alisma22_contig00025383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00025383 (822 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008453845.1 PREDICTED: mediator of RNA polymerase II transcri... 68 5e-10 XP_004146891.1 PREDICTED: mediator of RNA polymerase II transcri... 68 5e-10 KNA13364.1 hypothetical protein SOVF_117610 [Spinacia oleracea] 67 6e-10 KYP74970.1 Mediator of RNA polymerase II transcription subunit 3... 67 9e-10 XP_012090529.1 PREDICTED: mediator of RNA polymerase II transcri... 67 1e-09 XP_007143327.1 hypothetical protein PHAVU_007G063000g [Phaseolus... 67 1e-09 XP_017973515.1 PREDICTED: mediator of RNA polymerase II transcri... 67 1e-09 XP_017614419.1 PREDICTED: mediator of RNA polymerase II transcri... 67 1e-09 XP_016726497.1 PREDICTED: mediator of RNA polymerase II transcri... 67 1e-09 KDO57710.1 hypothetical protein CISIN_1g033637mg [Citrus sinensis] 65 1e-09 XP_007038222.2 PREDICTED: mediator of RNA polymerase II transcri... 67 1e-09 XP_010109149.1 Mediator of RNA polymerase II transcription subun... 67 1e-09 GAU15521.1 hypothetical protein TSUD_45580, partial [Trifolium s... 66 1e-09 XP_004496655.1 PREDICTED: mediator of RNA polymerase II transcri... 67 1e-09 OMO94785.1 Mediator complex, subunit Med31 [Corchorus capsularis] 67 1e-09 ALO61900.1 mediator of RNA polymerase II transcription subunit 3... 67 1e-09 XP_010676923.1 PREDICTED: mediator of RNA polymerase II transcri... 66 2e-09 XP_010676922.1 PREDICTED: mediator of RNA polymerase II transcri... 66 2e-09 XP_002279047.1 PREDICTED: mediator of RNA polymerase II transcri... 66 2e-09 XP_015877717.1 PREDICTED: mediator of RNA polymerase II transcri... 66 2e-09 >XP_008453845.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Cucumis melo] Length = 206 Score = 67.8 bits (164), Expect = 5e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 16 SSPTNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 54 >XP_004146891.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Cucumis sativus] KGN53186.1 hypothetical protein Csa_4G025160 [Cucumis sativus] Length = 206 Score = 67.8 bits (164), Expect = 5e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 16 SSPTNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 54 >KNA13364.1 hypothetical protein SOVF_117610 [Spinacia oleracea] Length = 197 Score = 67.4 bits (163), Expect = 6e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEF+QCLANPTYIH L+ + Sbjct: 15 SSTKNVYKDPDDGRQRFLLELEFIQCLANPTYIHYLAQN 53 >KYP74970.1 Mediator of RNA polymerase II transcription subunit 31 [Cajanus cajan] Length = 201 Score = 67.0 bits (162), Expect = 9e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 16 SSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 54 >XP_012090529.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Jatropha curcas] XP_012090530.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Jatropha curcas] Length = 204 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_007143327.1 hypothetical protein PHAVU_007G063000g [Phaseolus vulgaris] ESW15321.1 hypothetical protein PHAVU_007G063000g [Phaseolus vulgaris] Length = 207 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 16 SSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 54 >XP_017973515.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 isoform X2 [Theobroma cacao] Length = 208 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_017614419.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Gossypium arboreum] Length = 208 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_016726497.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31-like [Gossypium hirsutum] Length = 208 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >KDO57710.1 hypothetical protein CISIN_1g033637mg [Citrus sinensis] Length = 114 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS +Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKKVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_007038222.2 PREDICTED: mediator of RNA polymerase II transcription subunit 31 isoform X1 [Theobroma cacao] Length = 211 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_010109149.1 Mediator of RNA polymerase II transcription subunit 31 [Morus notabilis] EXC21078.1 Mediator of RNA polymerase II transcription subunit 31 [Morus notabilis] Length = 218 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >GAU15521.1 hypothetical protein TSUD_45580, partial [Trifolium subterraneum] Length = 182 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 301 NMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 3 NVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 37 >XP_004496655.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Cicer arietinum] XP_004496656.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Cicer arietinum] Length = 201 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +1 Query: 271 PLKRRWSSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 P+ S+ N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 10 PMDTTPSTPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 54 >OMO94785.1 Mediator complex, subunit Med31 [Corchorus capsularis] Length = 230 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 15 SSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >ALO61900.1 mediator of RNA polymerase II transcription subunit 31 [Rehmannia glutinosa] Length = 231 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 289 SSCINMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 SS N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 16 SSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 54 >XP_010676923.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 194 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 301 NMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 19 NVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_010676922.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 isoform X1 [Beta vulgaris subsp. vulgaris] KMT12492.1 hypothetical protein BVRB_5g104190 [Beta vulgaris subsp. vulgaris] Length = 197 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 301 NMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 19 NVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_002279047.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Vitis vinifera] CBI26590.3 unnamed protein product, partial [Vitis vinifera] Length = 198 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 301 NMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 19 NVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53 >XP_015877717.1 PREDICTED: mediator of RNA polymerase II transcription subunit 31 isoform X2 [Ziziphus jujuba] Length = 201 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 301 NMYTDPDDGRQRFLLELEFVQCLANPTYIHCLSDS 405 N+Y DPDDGRQRFLLELEFVQCLANPTYIH L+ + Sbjct: 19 NVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQN 53