BLASTX nr result
ID: Alisma22_contig00024802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00024802 (494 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019104869.1 PREDICTED: zinc finger BED domain-containing prot... 56 2e-06 KNZ51554.1 hypothetical protein VP01_390g11 [Puccinia sorghi] 55 8e-06 >XP_019104869.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 4-like [Beta vulgaris subsp. vulgaris] Length = 248 Score = 56.2 bits (134), Expect = 2e-06 Identities = 32/85 (37%), Positives = 44/85 (51%), Gaps = 3/85 (3%) Frame = -3 Query: 450 FVKVDATAEVSILKKRSRDRRSEVWSFFTKTKVGAVEKARCNACKALLATSGITGTSHLR 271 FV+ D E S K ++ S W++F V V+KA+C CK L+ SG +GTSHL Sbjct: 36 FVEGDKEKEASCDLKSNKKLTSGAWNYFDLVMVNGVKKAKCKNCKKTLSYSGSSGTSHLL 95 Query: 270 RHHFFTCPLRSSN---GEVTPKINQ 205 +H TC R N G+ KI + Sbjct: 96 KHANKTCSARHLNLAAGQTQLKIKE 120 >KNZ51554.1 hypothetical protein VP01_390g11 [Puccinia sorghi] Length = 764 Score = 55.1 bits (131), Expect = 8e-06 Identities = 34/91 (37%), Positives = 46/91 (50%) Frame = -3 Query: 399 RDRRSEVWSFFTKTKVGAVEKARCNACKALLATSGITGTSHLRRHHFFTCPLRSSNGEVT 220 R + S+VW+ FTK K GA KA C +C A L+ +GT+HL R HF C L V Sbjct: 43 RRKTSDVWNHFTKNKDGATTKAICLSCNATLSAQSNSGTNHLWR-HFNRCKLEPRQSLVV 101 Query: 219 PKINQVLSVVSRTRSSDKKSEVWSNFTKVVV 127 P+ Q +S R + V T++VV Sbjct: 102 PRGLQPISDHHRAPPRFNQEAVEEALTEMVV 132