BLASTX nr result
ID: Alisma22_contig00024518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00024518 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010274824.1 PREDICTED: uncharacterized protein LOC104610060 [... 52 1e-06 >XP_010274824.1 PREDICTED: uncharacterized protein LOC104610060 [Nelumbo nucifera] Length = 107 Score = 51.6 bits (122), Expect = 1e-06 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = -1 Query: 237 GHEGPDGLYYLDAPKTKAYLTTSVTDIQWHYCLGHPSPAKLKHLLPSM 94 GHE GLYYLD+ + L TS+T +QWH LGHPS LK L+P + Sbjct: 50 GHEA-SGLYYLDSGGSSVVLQTSLTPLQWHCRLGHPSLKALKRLVPPL 96