BLASTX nr result
ID: Alisma22_contig00024455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00024455 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU23857.1 Transcription factor RAX1, partial [Noccaea caerulesc... 53 5e-07 XP_016557471.1 PREDICTED: transcription factor MYB36-like [Capsi... 53 5e-07 CDP03217.1 unnamed protein product [Coffea canephora] 55 8e-07 XP_002974331.1 hypothetical protein SELMODRAFT_101484 [Selaginel... 52 1e-06 XP_009361466.1 PREDICTED: transcription factor MYB36-like [Pyrus... 55 1e-06 XP_019436061.1 PREDICTED: transcription factor RAX2-like [Lupinu... 55 1e-06 XP_009406763.1 PREDICTED: transcription factor MYB30-like [Musa ... 55 1e-06 EMT30324.1 Transcription factor RAX2 [Aegilops tauschii] 52 2e-06 CDY08749.1 BnaA06g24750D [Brassica napus] 51 2e-06 XP_002452939.1 hypothetical protein SORBIDRAFT_04g035300 [Sorghu... 51 2e-06 KGN48644.1 hypothetical protein Csa_6G496960 [Cucumis sativus] A... 51 2e-06 XP_013465930.1 myb transcription factor [Medicago truncatula] KE... 54 2e-06 XP_010086900.1 Transcription factor RAX1 [Morus notabilis] EXB24... 54 2e-06 CAI46244.1 Myb-like protein [Humulus lupulus] 54 2e-06 XP_017251393.1 PREDICTED: transcription factor RAX2-like isoform... 54 2e-06 EEF42898.1 r2r3-myb transcription factor, putative [Ricinus comm... 51 2e-06 XP_018445032.1 PREDICTED: transcription factor RAX1-like [Raphan... 54 2e-06 XP_009120615.1 PREDICTED: transcription factor RAX1-like [Brassi... 54 2e-06 CDY50326.1 BnaA10g13590D [Brassica napus] 54 2e-06 XP_013705873.1 PREDICTED: transcription factor RAX1-like isoform... 54 2e-06 >JAU23857.1 Transcription factor RAX1, partial [Noccaea caerulescens] Length = 87 Score = 53.1 bits (126), Expect = 5e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEED+ Sbjct: 8 MGRAPCCDKTKVKRGPWSPEEDS 30 >XP_016557471.1 PREDICTED: transcription factor MYB36-like [Capsicum annuum] Length = 89 Score = 53.1 bits (126), Expect = 5e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK+ VKRGPWSPEEDA Sbjct: 1 MGRAPCCDKNNVKRGPWSPEEDA 23 >CDP03217.1 unnamed protein product [Coffea canephora] Length = 261 Score = 55.5 bits (132), Expect = 8e-07 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDAV 323 MGRAPCCDK KVKRGPWSPEEDA+ Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDAI 24 >XP_002974331.1 hypothetical protein SELMODRAFT_101484 [Selaginella moellendorffii] XP_002990860.1 hypothetical protein SELMODRAFT_132315 [Selaginella moellendorffii] EFJ08133.1 hypothetical protein SELMODRAFT_132315 [Selaginella moellendorffii] EFJ24553.1 hypothetical protein SELMODRAFT_101484 [Selaginella moellendorffii] Length = 88 Score = 52.4 bits (124), Expect = 1e-06 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCC+KD VKRGPW+PEEDA Sbjct: 1 MGRAPCCEKDSVKRGPWTPEEDA 23 >XP_009361466.1 PREDICTED: transcription factor MYB36-like [Pyrus x bretschneideri] Length = 280 Score = 55.1 bits (131), Expect = 1e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDKD VKRGPWSPEEDA Sbjct: 1 MGRAPCCDKDNVKRGPWSPEEDA 23 >XP_019436061.1 PREDICTED: transcription factor RAX2-like [Lupinus angustifolius] Length = 291 Score = 55.1 bits (131), Expect = 1e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +3 Query: 249 AMGRAPCCDKDKVKRGPWSPEEDA 320 AMGRAPCCDK+ VKRGPWSPEEDA Sbjct: 16 AMGRAPCCDKENVKRGPWSPEEDA 39 >XP_009406763.1 PREDICTED: transcription factor MYB30-like [Musa acuminata subsp. malaccensis] Length = 399 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +3 Query: 153 HLSFKH--SIQLSSHSDVXXXXXXXXXXXXXRDSAMGRAPCCDKDKVKRGPWSPEEDA 320 HLSF S++ +++ + +AMGRAPCCDK KVKRGPWSP+EDA Sbjct: 92 HLSFHAFPSVEANTYFGLRRKKARERKATATATAAMGRAPCCDKAKVKRGPWSPDEDA 149 >EMT30324.1 Transcription factor RAX2 [Aegilops tauschii] Length = 95 Score = 52.0 bits (123), Expect = 2e-06 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK+ VK+GPWSPEEDA Sbjct: 1 MGRAPCCDKNNVKKGPWSPEEDA 23 >CDY08749.1 BnaA06g24750D [Brassica napus] Length = 51 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK VK+GPWSPEEDA Sbjct: 1 MGRAPCCDKANVKKGPWSPEEDA 23 >XP_002452939.1 hypothetical protein SORBIDRAFT_04g035300 [Sorghum bicolor] Length = 54 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK VK+GPWSPEEDA Sbjct: 1 MGRAPCCDKASVKKGPWSPEEDA 23 >KGN48644.1 hypothetical protein Csa_6G496960 [Cucumis sativus] ALN97495.1 DNA binding / transcription factor [Cucumis sativus] ALN97499.1 DNA binding / transcription factor [Cucumis sativus] ALN97503.1 DNA binding / transcription factor [Cucumis sativus] ALN97507.1 DNA binding / transcription factor [Cucumis sativus] ALN97511.1 DNA binding / transcription factor [Cucumis sativus] ALN97515.1 DNA binding / transcription factor [Cucumis sativus] ALN97519.1 DNA binding / transcription factor [Cucumis sativus] Length = 55 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK VK+GPWSPEEDA Sbjct: 1 MGRAPCCDKANVKKGPWSPEEDA 23 >XP_013465930.1 myb transcription factor [Medicago truncatula] KEH39966.1 myb transcription factor [Medicago truncatula] Length = 252 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK+KVKRGPWSP+EDA Sbjct: 1 MGRAPCCDKEKVKRGPWSPDEDA 23 >XP_010086900.1 Transcription factor RAX1 [Morus notabilis] EXB24691.1 Transcription factor RAX1 [Morus notabilis] Length = 260 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEEDA Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDA 23 >CAI46244.1 Myb-like protein [Humulus lupulus] Length = 264 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEEDA Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDA 23 >XP_017251393.1 PREDICTED: transcription factor RAX2-like isoform X1 [Daucus carota subsp. sativus] Length = 285 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 240 RDSAMGRAPCCDKDKVKRGPWSPEEDAV 323 R+ MGRAPCCDK KVKRGPWSP+ED + Sbjct: 19 REIRMGRAPCCDKSKVKRGPWSPQEDEI 46 >EEF42898.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 65 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK VK+GPWSPEEDA Sbjct: 1 MGRAPCCDKANVKKGPWSPEEDA 23 >XP_018445032.1 PREDICTED: transcription factor RAX1-like [Raphanus sativus] Length = 331 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEEDA Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDA 23 >XP_009120615.1 PREDICTED: transcription factor RAX1-like [Brassica rapa] XP_013665867.1 PREDICTED: transcription factor RAX1-like [Brassica napus] Length = 334 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEEDA Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDA 23 >CDY50326.1 BnaA10g13590D [Brassica napus] Length = 334 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEEDA Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDA 23 >XP_013705873.1 PREDICTED: transcription factor RAX1-like isoform X2 [Brassica napus] Length = 340 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 252 MGRAPCCDKDKVKRGPWSPEEDA 320 MGRAPCCDK KVKRGPWSPEEDA Sbjct: 1 MGRAPCCDKTKVKRGPWSPEEDA 23