BLASTX nr result
ID: Alisma22_contig00024032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00024032 (690 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010271764.1 PREDICTED: uncharacterized protein LOC104607768 [... 58 3e-06 KDO58841.1 hypothetical protein CISIN_1g0427012mg, partial [Citr... 53 3e-06 JAT42497.1 Envelope glycoprotein [Anthurium amnicola] JAT51362.1... 57 6e-06 >XP_010271764.1 PREDICTED: uncharacterized protein LOC104607768 [Nelumbo nucifera] Length = 1098 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 103 DFEEQSVLEQLQRYRRDRRVLLNFIMSGSLIKKV 2 D EE++ LE LQRYRRDRRVLLNFI+SGSLIKKV Sbjct: 3 DMEEENALELLQRYRRDRRVLLNFILSGSLIKKV 36 >KDO58841.1 hypothetical protein CISIN_1g0427012mg, partial [Citrus sinensis] Length = 61 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 97 EEQSVLEQLQRYRRDRRVLLNFIMSGSLIKKV 2 EE+ LE LQRYRRDRR+LL+FI+SGSLIKKV Sbjct: 2 EEEDALELLQRYRRDRRILLDFILSGSLIKKV 33 >JAT42497.1 Envelope glycoprotein [Anthurium amnicola] JAT51362.1 Envelope glycoprotein [Anthurium amnicola] Length = 1122 Score = 57.4 bits (137), Expect = 6e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 106 MDFEEQSVLEQLQRYRRDRRVLLNFIMSGSLIKKV 2 M EEQ+VLE LQRYRRDRR+LLNFI+SG+LIKKV Sbjct: 1 MSTEEQNVLELLQRYRRDRRLLLNFILSGNLIKKV 35