BLASTX nr result
ID: Alisma22_contig00023834
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00023834 (545 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008370829.1 PREDICTED: basic leucine zipper and W2 domain-con... 65 4e-09 XP_008370828.1 PREDICTED: basic leucine zipper and W2 domain-con... 65 4e-09 XP_016480677.1 PREDICTED: basic leucine zipper and W2 domain-con... 62 4e-09 JAT41593.1 Basic leucine zipper and W2 domain-containing protein... 65 5e-09 XP_020081015.1 basic leucine zipper and W2 domain-containing pro... 64 6e-09 XP_020081016.1 basic leucine zipper and W2 domain-containing pro... 64 7e-09 XP_018811211.1 PREDICTED: basic leucine zipper and W2 domain-con... 64 7e-09 OAY84125.1 Basic leucine zipper and W2 domain-containing protein... 64 7e-09 CDP04197.1 unnamed protein product [Coffea canephora] 64 9e-09 OAY34237.1 hypothetical protein MANES_12G005200 [Manihot esculenta] 64 9e-09 XP_008800962.1 PREDICTED: basic leucine zipper and W2 domain-con... 64 9e-09 XP_002514839.1 PREDICTED: basic leucine zipper and W2 domain-con... 64 9e-09 KMZ58733.1 Basic leucine zipper and W2 domain-containing protein... 64 9e-09 KMZ70732.1 Basic leucine zipper and W2 domain-containing protein... 64 9e-09 ONI05203.1 hypothetical protein PRUPE_6G361900 [Prunus persica] 64 1e-08 XP_011009963.1 PREDICTED: basic leucine zipper and W2 domain-con... 64 1e-08 XP_010673945.1 PREDICTED: basic leucine zipper and W2 domain-con... 64 1e-08 XP_008218452.1 PREDICTED: basic leucine zipper and W2 domain-con... 64 1e-08 XP_002270681.2 PREDICTED: basic leucine zipper and W2 domain-con... 64 1e-08 XP_006376044.1 eIF4-gamma/eIF5/eIF2-epsilon domain-containing fa... 64 1e-08 >XP_008370829.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 isoform X2 [Malus domestica] Length = 411 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTWAKLLNTFCTNGKLELELIYKVQ+QC Sbjct: 320 QVKTWAKLLNTFCTNGKLELELIYKVQMQC 349 >XP_008370828.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 isoform X1 [Malus domestica] Length = 412 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTWAKLLNTFCTNGKLELELIYKVQ+QC Sbjct: 321 QVKTWAKLLNTFCTNGKLELELIYKVQMQC 350 >XP_016480677.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Nicotiana tabacum] Length = 156 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWA+LLNTFCT GKLELELIYKVQ+QC Sbjct: 61 SALRQVKTWAQLLNTFCTTGKLELELIYKVQVQC 94 >JAT41593.1 Basic leucine zipper and W2 domain-containing protein 2 [Anthurium amnicola] Length = 411 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWA+LLNTFCTNGKLELEL+YKVQIQC Sbjct: 316 SALRQVKTWAELLNTFCTNGKLELELVYKVQIQC 349 >XP_020081015.1 basic leucine zipper and W2 domain-containing protein 2-like isoform X1 [Ananas comosus] Length = 376 Score = 64.3 bits (155), Expect = 6e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 ++ QVKTWAKLLN FCTNGKLELELIYK+QIQC Sbjct: 302 AVVRQVKTWAKLLNAFCTNGKLELELIYKIQIQC 335 >XP_020081016.1 basic leucine zipper and W2 domain-containing protein 2-like isoform X2 [Ananas comosus] Length = 390 Score = 64.3 bits (155), Expect = 7e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 ++ QVKTWAKLLN FCTNGKLELELIYK+QIQC Sbjct: 316 AVVRQVKTWAKLLNAFCTNGKLELELIYKIQIQC 349 >XP_018811211.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Juglans regia] Length = 411 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWAKLLNTFCTNGKLELEL+YKVQ+QC Sbjct: 316 SALRQVKTWAKLLNTFCTNGKLELELMYKVQMQC 349 >OAY84125.1 Basic leucine zipper and W2 domain-containing protein 2 [Ananas comosus] Length = 411 Score = 64.3 bits (155), Expect = 7e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 ++ QVKTWAKLLN FCTNGKLELELIYK+QIQC Sbjct: 316 AVVRQVKTWAKLLNAFCTNGKLELELIYKIQIQC 349 >CDP04197.1 unnamed protein product [Coffea canephora] Length = 378 Score = 63.9 bits (154), Expect = 9e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWAKLLNTFCT+GKLELELIYK+Q+QC Sbjct: 283 SALRQVKTWAKLLNTFCTSGKLELELIYKIQVQC 316 >OAY34237.1 hypothetical protein MANES_12G005200 [Manihot esculenta] Length = 411 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWA+LLNTFCTNGKLELELIYKVQ+QC Sbjct: 316 SALRQVKTWAELLNTFCTNGKLELELIYKVQMQC 349 >XP_008800962.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Phoenix dactylifera] Length = 411 Score = 63.9 bits (154), Expect = 9e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTWAKLLN FCTNGKLELEL+YKVQIQC Sbjct: 320 QVKTWAKLLNAFCTNGKLELELVYKVQIQC 349 >XP_002514839.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Ricinus communis] EEF47393.1 translation initiation factor, putative [Ricinus communis] Length = 411 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWA+LLNTFCTNGKLELELIYKVQ+QC Sbjct: 316 SALRQVKTWAELLNTFCTNGKLELELIYKVQMQC 349 >KMZ58733.1 Basic leucine zipper and W2 domain-containing protein [Zostera marina] Length = 412 Score = 63.9 bits (154), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTW+KLLNTFCTNG+LELELIYKVQIQC Sbjct: 321 QVKTWSKLLNTFCTNGRLELELIYKVQIQC 350 >KMZ70732.1 Basic leucine zipper and W2 domain-containing protein [Zostera marina] Length = 417 Score = 63.9 bits (154), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTW+KLLNTFCTNG+LELELIYKVQIQC Sbjct: 340 QVKTWSKLLNTFCTNGRLELELIYKVQIQC 369 >ONI05203.1 hypothetical protein PRUPE_6G361900 [Prunus persica] Length = 411 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTWA+LLNTFCTNGKLELELIYKVQ+QC Sbjct: 320 QVKTWAELLNTFCTNGKLELELIYKVQMQC 349 >XP_011009963.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Populus euphratica] Length = 411 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWA+LLNTFCTNGKLELEL+YKVQ+QC Sbjct: 316 SALRQVKTWAQLLNTFCTNGKLELELVYKVQMQC 349 >XP_010673945.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Beta vulgaris subsp. vulgaris] KMT14767.1 hypothetical protein BVRB_4g075330 [Beta vulgaris subsp. vulgaris] Length = 411 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWAKLLNT+CT+GKLELELIYKVQIQC Sbjct: 316 SALRQVKTWAKLLNTYCTSGKLELELIYKVQIQC 349 >XP_008218452.1 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Prunus mume] Length = 411 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVKTWA+LLNTFCTNGKLELELIYKVQ+QC Sbjct: 320 QVKTWAELLNTFCTNGKLELELIYKVQMQC 349 >XP_002270681.2 PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Vitis vinifera] Length = 411 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 92 QVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 QVK WAKLLNTFCTNGKLELEL+YKVQIQC Sbjct: 320 QVKAWAKLLNTFCTNGKLELELLYKVQIQC 349 >XP_006376044.1 eIF4-gamma/eIF5/eIF2-epsilon domain-containing family protein [Populus trichocarpa] ABK94573.1 unknown [Populus trichocarpa] ERP53841.1 eIF4-gamma/eIF5/eIF2-epsilon domain-containing family protein [Populus trichocarpa] Length = 411 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 SIFLQVKTWAKLLNTFCTNGKLELELIYKVQIQC 3 S QVKTWA+LLNTFCTNGKLELEL+YKVQ+QC Sbjct: 316 SALRQVKTWAQLLNTFCTNGKLELELVYKVQMQC 349