BLASTX nr result
ID: Alisma22_contig00023460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00023460 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB82708.1 hypothetical protein B456_013G210000 [Gossypium raimo... 52 4e-06 >KJB82708.1 hypothetical protein B456_013G210000 [Gossypium raimondii] Length = 195 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 117 KGTSTFEGLENFVHFLLLGGFYCLVRANDKNPGNSR 10 +GTST E L NF+ FLL GGFYCL+RA+ +NPG SR Sbjct: 159 RGTSTSEALVNFMQFLLPGGFYCLLRAHYENPGVSR 194