BLASTX nr result
ID: Alisma22_contig00022963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00022963 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDN61717.1 hypothetical protein CSUB01_04418, partial [Colletotr... 60 2e-09 >KDN61717.1 hypothetical protein CSUB01_04418, partial [Colletotrichum sublineola] Length = 65 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 381 DPQVQLGREGQAKEDHRYRPHAIPQDRLPQVQQRFPRR 268 DPQVQL REGQA++D R+RPHA+PQ RLP +Q+R P R Sbjct: 14 DPQVQLVREGQAEKDRRHRPHALPQGRLPPLQERLPDR 51