BLASTX nr result
ID: Alisma22_contig00022630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00022630 (547 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN13608.1 hypothetical protein AMTR_s00049p00062540 [Amborella ... 53 2e-06 >ERN13608.1 hypothetical protein AMTR_s00049p00062540 [Amborella trichopoda] Length = 72 Score = 53.1 bits (126), Expect = 2e-06 Identities = 35/64 (54%), Positives = 39/64 (60%) Frame = -1 Query: 547 GRIMLGAVRRRPCDSSLEVLELERSAGTKTPKSDALSIYEATLQKLRLGSRRAFATRAPT 368 G MLG RRP SS EL +K PK D+LSIYEATL+KLR GSR A+A P Sbjct: 5 GGYMLGM--RRPAPSS----ELLHRPHSKIPKQDSLSIYEATLEKLRAGSRIAWARPQPM 58 Query: 367 ETVK 356 E VK Sbjct: 59 EGVK 62