BLASTX nr result
ID: Alisma22_contig00022230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00022230 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010112427.1 putative mitochondrial protein [Morus notabilis] ... 67 9e-11 EEF27385.1 conserved hypothetical protein [Ricinus communis] 52 9e-07 EEF22255.1 conserved hypothetical protein [Ricinus communis] 52 2e-06 EEF22868.1 conserved hypothetical protein, partial [Ricinus comm... 52 2e-06 >XP_010112427.1 putative mitochondrial protein [Morus notabilis] EXC33548.1 putative mitochondrial protein [Morus notabilis] Length = 478 Score = 66.6 bits (161), Expect = 9e-11 Identities = 45/97 (46%), Positives = 53/97 (54%), Gaps = 10/97 (10%) Frame = -3 Query: 297 PVQSPPIGGLSTTGGYSPN-----VGLGQHSI*VVRST-DPTLSRAGCRPRWSWEPAPPL 136 PVQSPP GLSTT S + LG + S DPT SRAGCRPRWSWEP Sbjct: 256 PVQSPPRSGLSTTLSLSQTNAPHQISLGWGKTAMSSSLQDPTPSRAGCRPRWSWEPTYTF 315 Query: 135 CQCLAPK--IEGRAPKRKQSSLFER--VGSVE*RTDK 37 P+ + RAPKR Q SLF++ +GS TD+ Sbjct: 316 LGLALPQHLNKRRAPKRNQPSLFKKALLGSASESTDE 352 >EEF27385.1 conserved hypothetical protein [Ricinus communis] Length = 81 Score = 52.0 bits (123), Expect = 9e-07 Identities = 26/46 (56%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 198 DPTLSRAGCRPRWSWEPAPPLCQCLAPK--IEGRAPKRKQSSLFER 67 D T SRAGCRPRWSWEP P+ + RAPKRKQ SLF++ Sbjct: 22 DSTPSRAGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQPSLFKK 67 >EEF22255.1 conserved hypothetical protein [Ricinus communis] Length = 108 Score = 52.0 bits (123), Expect = 2e-06 Identities = 26/46 (56%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 198 DPTLSRAGCRPRWSWEPAPPLCQCLAPK--IEGRAPKRKQSSLFER 67 D T SRAGCRPRWSWEP P+ + RAPKRKQ SLF++ Sbjct: 49 DSTPSRAGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQPSLFKK 94 >EEF22868.1 conserved hypothetical protein, partial [Ricinus communis] Length = 124 Score = 52.0 bits (123), Expect = 2e-06 Identities = 26/46 (56%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 198 DPTLSRAGCRPRWSWEPAPPLCQCLAPK--IEGRAPKRKQSSLFER 67 D T SRAGCRPRWSWEP P+ + RAPKRKQ SLF++ Sbjct: 65 DSTPSRAGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQPSLFKK 110