BLASTX nr result
ID: Alisma22_contig00021959
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00021959 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ANC33519.1 UDP-xylose 4-epimerase [Ornithogalum longebracteatum] 56 1e-06 KDP34859.1 hypothetical protein JCGZ_09147 [Jatropha curcas] 55 3e-06 XP_008808535.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 55 3e-06 XP_008808533.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 55 3e-06 XP_008808532.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 i... 55 3e-06 XP_008439507.2 PREDICTED: LOW QUALITY PROTEIN: UDP-arabinose 4-e... 55 3e-06 XP_014623551.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Glyc... 55 3e-06 XP_008808531.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 55 3e-06 XP_017702458.1 PREDICTED: LOW QUALITY PROTEIN: probable UDP-arab... 55 3e-06 XP_012075532.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Jatr... 55 3e-06 XP_008808530.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 55 3e-06 XP_002270765.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vin... 55 3e-06 XP_017701523.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 55 3e-06 XP_010941588.2 PREDICTED: probable UDP-arabinose 4-epimerase 3 i... 55 3e-06 XP_010941587.2 PREDICTED: probable UDP-arabinose 4-epimerase 3 i... 55 3e-06 XP_010941586.2 PREDICTED: probable UDP-arabinose 4-epimerase 3 i... 55 3e-06 KHG26599.1 hypothetical protein F383_05651 [Gossypium arboreum] 55 4e-06 XP_010926898.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 i... 55 4e-06 XP_019707520.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 i... 55 4e-06 XP_017648204.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 [... 55 4e-06 >ANC33519.1 UDP-xylose 4-epimerase [Ornithogalum longebracteatum] Length = 416 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESLRVAWRWQKSH NGY S Sbjct: 384 TAQYTDLQESLRVAWRWQKSHPNGYGS 410 >KDP34859.1 hypothetical protein JCGZ_09147 [Jatropha curcas] Length = 401 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQ+TDL+ESL++AWRWQKSHRNGY S Sbjct: 369 TAQHTDLQESLQIAWRWQKSHRNGYGS 395 >XP_008808535.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X6 [Phoenix dactylifera] Length = 405 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 373 TAQYTDLQESLSIAWKWQKSHRNGYGS 399 >XP_008808533.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X5 [Phoenix dactylifera] Length = 410 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 378 TAQYTDLQESLSIAWKWQKSHRNGYGS 404 >XP_008808532.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X4 [Phoenix dactylifera] Length = 410 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 378 TAQYTDLQESLSIAWKWQKSHRNGYGS 404 >XP_008439507.2 PREDICTED: LOW QUALITY PROTEIN: UDP-arabinose 4-epimerase 1-like [Cucumis melo] Length = 412 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDLE+SL+VAWRWQKSH NGY S Sbjct: 385 TAQYTDLEQSLKVAWRWQKSHLNGYES 411 >XP_014623551.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Glycine max] XP_014623552.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Glycine max] KHN14279.1 UDP-arabinose 4-epimerase 1 [Glycine soja] KRH11870.1 hypothetical protein GLYMA_15G136000 [Glycine max] KRH11871.1 hypothetical protein GLYMA_15G136000 [Glycine max] Length = 415 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSSL 86 TAQYTDLE+SL+VAW+WQKSHRNGY L Sbjct: 385 TAQYTDLEKSLQVAWKWQKSHRNGYGIL 412 >XP_008808531.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X3 [Phoenix dactylifera] Length = 415 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 383 TAQYTDLQESLSIAWKWQKSHRNGYGS 409 >XP_017702458.1 PREDICTED: LOW QUALITY PROTEIN: probable UDP-arabinose 4-epimerase 3 [Phoenix dactylifera] Length = 417 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSSL*VL 95 TA+YTDL+ESL +AWRWQKSHRNGY S VL Sbjct: 385 TARYTDLQESLSIAWRWQKSHRNGYGSPSVL 415 >XP_012075532.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Jatropha curcas] XP_012075533.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Jatropha curcas] Length = 417 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQ+TDL+ESL++AWRWQKSHRNGY S Sbjct: 385 TAQHTDLQESLQIAWRWQKSHRNGYGS 411 >XP_008808530.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X2 [Phoenix dactylifera] Length = 417 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 385 TAQYTDLQESLSIAWKWQKSHRNGYGS 411 >XP_002270765.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] XP_010655777.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] XP_010655778.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] XP_010655779.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] XP_019078317.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] CBI31081.3 unnamed protein product, partial [Vitis vinifera] Length = 418 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TA+YTDL+ESLRVAWRWQK+HRNGY + Sbjct: 385 TAKYTDLQESLRVAWRWQKAHRNGYGT 411 >XP_017701523.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Phoenix dactylifera] XP_017701524.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Phoenix dactylifera] Length = 422 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 390 TAQYTDLQESLSIAWKWQKSHRNGYGS 416 >XP_010941588.2 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X3 [Elaeis guineensis] Length = 524 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 492 TAQYTDLQESLSIAWKWQKSHRNGYGS 518 >XP_010941587.2 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X2 [Elaeis guineensis] Length = 531 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 499 TAQYTDLQESLSIAWKWQKSHRNGYGS 525 >XP_010941586.2 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X1 [Elaeis guineensis] Length = 535 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AW+WQKSHRNGY S Sbjct: 503 TAQYTDLQESLSIAWKWQKSHRNGYGS 529 >KHG26599.1 hypothetical protein F383_05651 [Gossypium arboreum] Length = 376 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSSL 86 TA++TDL+ESL +AWRWQK+HRNGYSSL Sbjct: 349 TARFTDLQESLGIAWRWQKAHRNGYSSL 376 >XP_010926898.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X3 [Elaeis guineensis] Length = 396 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AWRWQKSH+NGY S Sbjct: 364 TAQYTDLQESLSIAWRWQKSHQNGYGS 390 >XP_019707520.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X2 [Elaeis guineensis] XP_019707521.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X2 [Elaeis guineensis] Length = 410 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSS 83 TAQYTDL+ESL +AWRWQKSH+NGY S Sbjct: 378 TAQYTDLQESLSIAWRWQKSHQNGYGS 404 >XP_017648204.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 [Gossypium arboreum] Length = 412 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 3 TAQYTDLEESLRVAWRWQKSHRNGYSSL 86 TA++TDL+ESL +AWRWQK+HRNGYSSL Sbjct: 385 TARFTDLQESLGIAWRWQKAHRNGYSSL 412