BLASTX nr result
ID: Alisma22_contig00021629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00021629 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF34888.1 conserved hypothetical protein [Ricinus communis] 60 4e-10 KVH95780.1 hypothetical protein Ccrd_002162 [Cynara cardunculus ... 50 3e-06 >EEF34888.1 conserved hypothetical protein [Ricinus communis] Length = 60 Score = 59.7 bits (143), Expect = 4e-10 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +1 Query: 76 LWLARSKFAAESCGLG*GPSRISPGEEGTMLGWLHRAALPPAVDSGRITSPCLPG 240 +WLARSK + CGLG GP + P EGT LGW HRAA+ + P LPG Sbjct: 2 IWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLPG 56 >KVH95780.1 hypothetical protein Ccrd_002162 [Cynara cardunculus var. scolymus] Length = 72 Score = 50.1 bits (118), Expect = 3e-06 Identities = 26/56 (46%), Positives = 28/56 (50%) Frame = +1 Query: 76 LWLARSKFAAESCGLG*GPSRISPGEEGTMLGWLHRAALPPAVDSGRITSPCLPGP 243 +WLARSKF A CGLG G + P EG LGW HRAA P P P Sbjct: 16 IWLARSKFGAGPCGLGEGLGFMVPKVEGNALGWFHRAAKTSLSKQWEDNRPVHPRP 71