BLASTX nr result
ID: Alisma22_contig00021492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00021492 (674 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT44210.1 Thymidine kinase, partial [Anthurium amnicola] 54 1e-06 >JAT44210.1 Thymidine kinase, partial [Anthurium amnicola] Length = 501 Score = 54.3 bits (129), Expect(2) = 1e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 673 DNRLLFSLRYQQLEGID*LGYCITGRESWRNVVVSVDNLRRWAAPL 536 D RLLFSLR+QQLEG+ L Y + R+SW +VVVSVDN+R PL Sbjct: 248 DERLLFSLRHQQLEGVVQLAYKLLFRDSWIDVVVSVDNIRCDVKPL 293 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 555 DVGRLLSTSLMEQRRLGSKEK 493 DV LLS +LM +R LGS+EK Sbjct: 289 DVKPLLSETLMTERGLGSEEK 309