BLASTX nr result
ID: Alisma22_contig00020996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020996 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015888204.1 PREDICTED: primary amine oxidase-like [Ziziphus j... 53 3e-06 XP_019057554.1 PREDICTED: primary amine oxidase-like [Tarenaya h... 52 8e-06 >XP_015888204.1 PREDICTED: primary amine oxidase-like [Ziziphus jujuba] Length = 903 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/50 (52%), Positives = 30/50 (60%) Frame = +1 Query: 106 HPLDPLTPSEXXXXXXXXXXXXXXXNSTGDALRFHYVALDEPDKPTLLSW 255 HPLDPLTPSE ++ D + FHYV LD+PDKPTLLSW Sbjct: 32 HPLDPLTPSEINQVQTIIKQTFN--TTSKDNITFHYVGLDDPDKPTLLSW 79 >XP_019057554.1 PREDICTED: primary amine oxidase-like [Tarenaya hassleriana] Length = 679 Score = 52.0 bits (123), Expect = 8e-06 Identities = 28/54 (51%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +1 Query: 103 THPLDPLTPSEXXXXXXXXXXXXXXXNSTGDA---LRFHYVALDEPDKPTLLSW 255 THPLDPLTPSE N GD+ L FHYVALDEP+KP +L W Sbjct: 26 THPLDPLTPSEITRIQSIIN------NHFGDSKRNLNFHYVALDEPEKPAVLKW 73