BLASTX nr result
ID: Alisma22_contig00020974
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020974 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRG92672.1 hypothetical protein GLYMA_20G224400 [Glycine max] 55 9e-07 ABI26716.1 GDP-mannose 3,5-epimerase, partial [Vitis vinifera] 52 2e-06 AJC01342.1 GDP-D-mannose-3 5-epimerase, partial [Myrciaria dubia] 52 2e-06 AFK45963.1 unknown [Lotus japonicus] 52 3e-06 AFK42235.1 unknown [Lotus japonicus] 52 3e-06 AGO64471.1 GDP-D-mannose-3',5'-epimerase, partial [Rosa roxburghii] 52 8e-06 ABA94523.1 NAD dependent epimerase/dehydratase family protein, e... 52 8e-06 OAY73644.1 GDP-mannose 3,5-epimerase 2, partial [Ananas comosus] 52 9e-06 XP_017977555.1 PREDICTED: GDP-mannose 3,5-epimerase 2 [Theobroma... 52 1e-05 >KRG92672.1 hypothetical protein GLYMA_20G224400 [Glycine max] Length = 272 Score = 55.1 bits (131), Expect = 9e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLRY*LS 132 +WGDGLQTRSFTFIDECVEGVLRY L+ Sbjct: 234 MWGDGLQTRSFTFIDECVEGVLRYVLA 260 >ABI26716.1 GDP-mannose 3,5-epimerase, partial [Vitis vinifera] Length = 106 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLR 120 +WGDGLQTRSFTFIDECVEGVLR Sbjct: 12 MWGDGLQTRSFTFIDECVEGVLR 34 >AJC01342.1 GDP-D-mannose-3 5-epimerase, partial [Myrciaria dubia] Length = 110 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLR 120 +WGDGLQTRSFTFIDECVEGVLR Sbjct: 69 MWGDGLQTRSFTFIDECVEGVLR 91 >AFK45963.1 unknown [Lotus japonicus] Length = 143 Score = 52.0 bits (123), Expect = 3e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLR 120 +WGDGLQTRSFTFIDECVEGVLR Sbjct: 1 MWGDGLQTRSFTFIDECVEGVLR 23 >AFK42235.1 unknown [Lotus japonicus] Length = 143 Score = 52.0 bits (123), Expect = 3e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLR 120 +WGDGLQTRSFTFIDECVEGVLR Sbjct: 1 MWGDGLQTRSFTFIDECVEGVLR 23 >AGO64471.1 GDP-D-mannose-3',5'-epimerase, partial [Rosa roxburghii] Length = 209 Score = 52.0 bits (123), Expect = 8e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLR 120 +WGDGLQTRSFTFIDECVEGVLR Sbjct: 138 MWGDGLQTRSFTFIDECVEGVLR 160 >ABA94523.1 NAD dependent epimerase/dehydratase family protein, expressed [Oryza sativa Japonica Group] Length = 265 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLRY*LSLLST 144 +WGDGLQTRSFTFIDECVEGVLR + L T Sbjct: 229 MWGDGLQTRSFTFIDECVEGVLRSAFATLIT 259 >OAY73644.1 GDP-mannose 3,5-epimerase 2, partial [Ananas comosus] Length = 224 Score = 52.0 bits (123), Expect = 9e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLR 120 +WGDGLQTRSFTFIDECVEGVLR Sbjct: 133 MWGDGLQTRSFTFIDECVEGVLR 155 >XP_017977555.1 PREDICTED: GDP-mannose 3,5-epimerase 2 [Theobroma cacao] Length = 426 Score = 52.4 bits (124), Expect = 1e-05 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 52 LWGDGLQTRSFTFIDECVEGVLRY*LS 132 +WGDGLQTRSFTFIDECVEGVLR +S Sbjct: 284 MWGDGLQTRSFTFIDECVEGVLRLTMS 310