BLASTX nr result
ID: Alisma22_contig00020718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020718 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009381120.1 PREDICTED: EG45-like domain containing protein [M... 63 1e-10 OAY72030.1 EG45-like domain containing protein [Ananas comosus] 62 7e-10 XP_020089599.1 EG45-like domain containing protein [Ananas comosus] 59 4e-09 XP_012078764.1 PREDICTED: EG45-like domain containing protein [J... 59 5e-09 XP_008792052.1 PREDICTED: EG45-like domain containing protein [P... 59 6e-09 XP_010250070.1 PREDICTED: EG45-like domain containing protein [N... 57 1e-08 OAY31680.1 hypothetical protein MANES_14G131600 [Manihot esculenta] 57 2e-08 XP_010914875.1 PREDICTED: EG45-like domain containing protein [E... 57 3e-08 XP_010254377.1 PREDICTED: EG45-like domain containing protein [N... 56 5e-08 AEZ51610.1 avirulent on Ve1, partial [Colletotrichum higginsianum] 55 7e-08 XP_012857866.1 PREDICTED: EG45-like domain containing protein 2 ... 55 9e-08 KDO61699.1 hypothetical protein CISIN_1g039202mg, partial [Citru... 54 1e-07 XP_002524475.2 PREDICTED: EG45-like domain containing protein [R... 55 2e-07 XP_009408972.1 PREDICTED: EG45-like domain containing protein is... 55 2e-07 EEF37915.1 conserved hypothetical protein [Ricinus communis] 55 2e-07 EYU20273.1 hypothetical protein MIMGU_mgv1a019531mg, partial [Er... 55 2e-07 XP_018684398.1 PREDICTED: EG45-like domain containing protein is... 55 2e-07 CDP13494.1 unnamed protein product [Coffea canephora] 54 2e-07 XP_008811083.1 PREDICTED: EG45-like domain containing protein [P... 54 3e-07 XP_006450476.1 hypothetical protein CICLE_v10010610mg, partial [... 54 3e-07 >XP_009381120.1 PREDICTED: EG45-like domain containing protein [Musa acuminata subsp. malaccensis] Length = 134 Score = 62.8 bits (151), Expect = 1e-10 Identities = 29/52 (55%), Positives = 35/52 (67%), Gaps = 8/52 (15%) Frame = +2 Query: 128 WVSIACL--------LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 WV++A L L +ADVGTATSY PPYLPT+CPG D+LP+ GLF Sbjct: 6 WVAVAMLFGLICDVYLVTVSADVGTATSYDPPYLPTKCPGYTEDQLPENGLF 57 >OAY72030.1 EG45-like domain containing protein [Ananas comosus] Length = 189 Score = 62.0 bits (149), Expect = 7e-10 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 164 ADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 ADVGTATSY PPYLPTRCPG +RDRLP GLF Sbjct: 82 ADVGTATSYDPPYLPTRCPGYDRDRLPGSGLF 113 >XP_020089599.1 EG45-like domain containing protein [Ananas comosus] Length = 135 Score = 58.9 bits (141), Expect = 4e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 164 ADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 ADVGTATSY PPYLPTRCPG ++D+LP GLF Sbjct: 27 ADVGTATSYDPPYLPTRCPGYDQDQLPGSGLF 58 >XP_012078764.1 PREDICTED: EG45-like domain containing protein [Jatropha curcas] KDP32388.1 hypothetical protein JCGZ_13313 [Jatropha curcas] Length = 133 Score = 58.5 bits (140), Expect = 5e-09 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +2 Query: 149 LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 +A+ AD+GTATSY PPYLPTRC G N D+ P GG F Sbjct: 21 IALVAADIGTATSYDPPYLPTRCKGYNEDQFPPGGYF 57 >XP_008792052.1 PREDICTED: EG45-like domain containing protein [Phoenix dactylifera] Length = 134 Score = 58.5 bits (140), Expect = 6e-09 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +2 Query: 131 VSIACLLAVA--TADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 + + C L + +ADVGTATSY PPYLPT+C G N+D+LP GLF Sbjct: 13 IGLLCALDITRVSADVGTATSYGPPYLPTKCSGYNQDQLPGNGLF 57 >XP_010250070.1 PREDICTED: EG45-like domain containing protein [Nelumbo nucifera] Length = 129 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +2 Query: 155 VATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLFA 262 V T DVGTA+SY PPYLPTRC G ++++ P+GGLFA Sbjct: 19 VVTGDVGTASSYEPPYLPTRCNGYDQNQFPEGGLFA 54 >OAY31680.1 hypothetical protein MANES_14G131600 [Manihot esculenta] Length = 131 Score = 57.0 bits (136), Expect = 2e-08 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +2 Query: 128 WVSIACLLAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 WV +LA DVGTATSY PPYLPTRC G + D+ P+GG F Sbjct: 13 WVCFESILAAG--DVGTATSYDPPYLPTRCRGYSEDQFPEGGYF 54 >XP_010914875.1 PREDICTED: EG45-like domain containing protein [Elaeis guineensis] Length = 131 Score = 56.6 bits (135), Expect = 3e-08 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +2 Query: 131 VSIACLLAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 + C V+ ADVGTATSY PPYLPT+C G N+D++P GLF Sbjct: 13 IGFLCFTRVS-ADVGTATSYDPPYLPTKCSGYNQDQMPGNGLF 54 >XP_010254377.1 PREDICTED: EG45-like domain containing protein [Nelumbo nucifera] Length = 138 Score = 56.2 bits (134), Expect = 5e-08 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +2 Query: 128 WVSIACLLAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLFA 262 W+ + LL DVGTATSY PPYLPT+C G ++++ P+GGLFA Sbjct: 20 WLCVDILLI--KGDVGTATSYDPPYLPTKCSGYDQNQFPEGGLFA 62 >AEZ51610.1 avirulent on Ve1, partial [Colletotrichum higginsianum] Length = 123 Score = 55.5 bits (132), Expect = 7e-08 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +2 Query: 137 IACLLAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 + L ++A+AD+GTA YSPPYLPTRC G+N ++ P G LF Sbjct: 6 LGALASLASADIGTAGPYSPPYLPTRCYGNNMNQFPPGNLF 46 >XP_012857866.1 PREDICTED: EG45-like domain containing protein 2 [Erythranthe guttata] Length = 134 Score = 55.5 bits (132), Expect = 9e-08 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 134 SIACL-LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 SI+C +++ +AD+GTATSY PPY PT+C G+ +D+ P G LF Sbjct: 15 SISCKEMSLVSADIGTATSYDPPYTPTKCNGNRQDQFPSGNLF 57 >KDO61699.1 hypothetical protein CISIN_1g039202mg, partial [Citrus sinensis] Length = 92 Score = 53.9 bits (128), Expect = 1e-07 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 149 LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 L+ AD+GTAT+Y PPYLPTRC G+ +D+ P G LF Sbjct: 18 LSFVFADIGTATAYHPPYLPTRCNGNRQDQFPPGNLF 54 >XP_002524475.2 PREDICTED: EG45-like domain containing protein [Ricinus communis] Length = 130 Score = 54.7 bits (130), Expect = 2e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 158 ATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 AT D+G+ATSY PPYLPTRC G + D+ P GG F Sbjct: 20 ATGDIGSATSYDPPYLPTRCKGYSEDQFPQGGYF 53 >XP_009408972.1 PREDICTED: EG45-like domain containing protein isoform X2 [Musa acuminata subsp. malaccensis] Length = 162 Score = 55.1 bits (131), Expect = 2e-07 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = +2 Query: 131 VSIACLLAV--ATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 + +AC + + + DVGTATSY PPYLPT+CPG +D+LP G F Sbjct: 41 IGLACAVDLIGVSGDVGTATSYGPPYLPTKCPGYTQDQLPGNGHF 85 >EEF37915.1 conserved hypothetical protein [Ricinus communis] Length = 143 Score = 54.7 bits (130), Expect = 2e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 158 ATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 AT D+G+ATSY PPYLPTRC G + D+ P GG F Sbjct: 20 ATGDIGSATSYDPPYLPTRCKGYSEDQFPQGGYF 53 >EYU20273.1 hypothetical protein MIMGU_mgv1a019531mg, partial [Erythranthe guttata] Length = 190 Score = 55.5 bits (132), Expect = 2e-07 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 134 SIACL-LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 SI+C +++ +AD+GTATSY PPY PT+C G+ +D+ P G LF Sbjct: 40 SISCKEMSLVSADIGTATSYDPPYTPTKCNGNRQDQFPSGNLF 82 >XP_018684398.1 PREDICTED: EG45-like domain containing protein isoform X1 [Musa acuminata subsp. malaccensis] Length = 173 Score = 55.1 bits (131), Expect = 2e-07 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = +2 Query: 131 VSIACLLAV--ATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 + +AC + + + DVGTATSY PPYLPT+CPG +D+LP G F Sbjct: 41 IGLACAVDLIGVSGDVGTATSYGPPYLPTKCPGYTQDQLPGNGHF 85 >CDP13494.1 unnamed protein product [Coffea canephora] Length = 133 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 131 VSIACL-LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 +S+ C +++ D+GTATSYSPPY+PTRC G+ D+ P G LF Sbjct: 11 ISLFCSEISLVRGDIGTATSYSPPYIPTRCNGNRPDQFPAGNLF 54 >XP_008811083.1 PREDICTED: EG45-like domain containing protein [Phoenix dactylifera] Length = 140 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 131 VSIACLLAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLFA 262 +S+A LL +TADVGTA Y PPYLPT C G ++++ P GLFA Sbjct: 14 LSLAILLRPSTADVGTAAYYGPPYLPTVCYGRDQEQFPASGLFA 57 >XP_006450476.1 hypothetical protein CICLE_v10010610mg, partial [Citrus clementina] ESR63716.1 hypothetical protein CICLE_v10010610mg, partial [Citrus clementina] Length = 128 Score = 53.9 bits (128), Expect = 3e-07 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 149 LAVATADVGTATSYSPPYLPTRCPGDNRDRLPDGGLF 259 L+ AD+GTAT+Y PPYLPTRC G+ +D+ P G LF Sbjct: 18 LSFVFADIGTATAYHPPYLPTRCNGNRQDQFPPGNLF 54