BLASTX nr result
ID: Alisma22_contig00020435
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020435 (536 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010917185.1 PREDICTED: uncharacterized protein At1g04910 [Ela... 56 6e-06 >XP_010917185.1 PREDICTED: uncharacterized protein At1g04910 [Elaeis guineensis] Length = 620 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 184 RVNSPRFAANMTRRAQSFKRGGH-DVELQINSPRS 83 RVNSPR+A +MTRRA SFKRGG+ ++ELQINSPRS Sbjct: 24 RVNSPRYAGSMTRRAHSFKRGGNGEIELQINSPRS 58