BLASTX nr result
ID: Alisma22_contig00020262
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020262 (685 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_358581.1 hypothetical protein PhapfoPp032 [Phalaenopsis aphro... 85 1e-17 CBI21459.3 unnamed protein product, partial [Vitis vinifera] 60 9e-09 KFK40397.1 hypothetical protein AALP_AA3G368200 [Arabis alpina] 56 2e-07 XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [... 54 2e-06 >YP_358581.1 hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] AAW82556.1 hypothetical protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 84.7 bits (208), Expect = 1e-17 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -2 Query: 684 RAIRIRTVDLLGKTDQTY*YRNDSNCFKDPTCILLHWALS*TDEKIS 544 RAIR RTVDLLGKT++TY YRND NCFKDPTCILLHWALS TD KIS Sbjct: 57 RAIRTRTVDLLGKTEKTYYYRNDLNCFKDPTCILLHWALSSTDVKIS 103 >CBI21459.3 unnamed protein product, partial [Vitis vinifera] Length = 79 Score = 60.5 bits (145), Expect = 9e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 684 RAIRIRTVDLLGKTDQTY*YRNDSNCFKDPTCI 586 RAIR RTVDLLGKTDQT Y+ND NCFKDPTCI Sbjct: 38 RAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCI 70 >KFK40397.1 hypothetical protein AALP_AA3G368200 [Arabis alpina] Length = 42 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 580 QQNACWVFETVRIISILISLICFTEKVYGSNPYSP 684 ++NACWVFE VRII I+IS FTE+VYGS+PYSP Sbjct: 7 KKNACWVFERVRIILIIISSNSFTEQVYGSSPYSP 41 >XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] ESW31448.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] Length = 53 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 684 RAIRIRTVDLLGKTDQTY*YRNDSNCFKDPTCILL 580 RAIR RTVDLLGKT +T+ Y ND NCF +PTCI L Sbjct: 12 RAIRTRTVDLLGKTAKTHYYLNDFNCFLNPTCIFL 46