BLASTX nr result
ID: Alisma22_contig00020118
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020118 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAJ99739.1 predicted protein [Hordeum vulgare subsp. vulgare] BA... 52 7e-06 >BAJ99739.1 predicted protein [Hordeum vulgare subsp. vulgare] BAJ96583.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 164 Score = 52.4 bits (124), Expect = 7e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 94 MEKTISKFFDSVGDFFNASERIPWCDRDIVA 2 ME +SKFFDSVG FF+ + IPWCDRDI+A Sbjct: 1 MEAKMSKFFDSVGSFFSGGDNIPWCDRDIIA 31