BLASTX nr result
ID: Alisma22_contig00020037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00020037 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY20386.1 Disease resistance protein RPS2, partial [Theobroma c... 52 6e-06 XP_008219398.1 PREDICTED: putative disease resistance protein RG... 54 6e-06 XP_002458657.1 hypothetical protein SORBIDRAFT_03g037540 [Sorghu... 54 6e-06 KDO55755.1 hypothetical protein CISIN_1g0448782mg, partial [Citr... 52 8e-06 >EOY20386.1 Disease resistance protein RPS2, partial [Theobroma cacao] Length = 106 Score = 51.6 bits (122), Expect = 6e-06 Identities = 22/50 (44%), Positives = 36/50 (72%) Frame = -1 Query: 313 METIDSYLQDADSKQVRYRSVFNWLSDLQEVSYDAEDILDGYSTDVAGLK 164 + I + L DA+ KQ++ + V NWL+DLQ+++YD +DILD ++T+ G K Sbjct: 45 LRDIRAVLDDAEGKQMKDQYVKNWLADLQDLAYDVDDILDEFATEALGRK 94 >XP_008219398.1 PREDICTED: putative disease resistance protein RGA3 [Prunus mume] XP_008219400.1 PREDICTED: putative disease resistance protein RGA3 [Prunus mume] XP_008219401.1 PREDICTED: putative disease resistance protein RGA3 [Prunus mume] XP_008219402.1 PREDICTED: putative disease resistance protein RGA3 [Prunus mume] XP_016647889.1 PREDICTED: putative disease resistance protein RGA3 [Prunus mume] XP_016647890.1 PREDICTED: putative disease resistance protein RGA3 [Prunus mume] Length = 963 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/53 (43%), Positives = 36/53 (67%) Frame = -1 Query: 334 VDGLFLKMETIDSYLQDADSKQVRYRSVFNWLSDLQEVSYDAEDILDGYSTDV 176 V L + I + LQDA+ +QV+ SV NWL +L++VSYD D+LD ++T++ Sbjct: 31 VKNLIIHFNAIQAVLQDAEERQVKEESVRNWLQNLEDVSYDINDVLDEWNTEI 83 >XP_002458657.1 hypothetical protein SORBIDRAFT_03g037540 [Sorghum bicolor] EES03777.1 hypothetical protein SORBI_003G329300 [Sorghum bicolor] Length = 1112 Score = 54.3 bits (129), Expect = 6e-06 Identities = 22/57 (38%), Positives = 39/57 (68%) Frame = -1 Query: 334 VDGLFLKMETIDSYLQDADSKQVRYRSVFNWLSDLQEVSYDAEDILDGYSTDVAGLK 164 ++ L + + ++L DA++KQ+ SV WL+ L++++YD +D+LD YST + GLK Sbjct: 36 LENLSCTLSQLQAFLDDAEAKQLTDASVRGWLAKLKDIAYDTDDLLDSYSTKILGLK 92 >KDO55755.1 hypothetical protein CISIN_1g0448782mg, partial [Citrus sinensis] Length = 140 Score = 52.0 bits (123), Expect = 8e-06 Identities = 25/50 (50%), Positives = 40/50 (80%) Frame = -1 Query: 313 METIDSYLQDADSKQVRYRSVFNWLSDLQEVSYDAEDILDGYSTDVAGLK 164 ++TI++ L DA+ KQ+ R+V WL DL++++YDAEDILD ++T+ AGL+ Sbjct: 31 LKTIEAVLIDAEEKQLTDRAVKLWLDDLRDLAYDAEDILDEFATE-AGLR 79