BLASTX nr result
ID: Alisma22_contig00019740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00019740 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT42634.1 40S ribosomal protein S15a [Anthurium amnicola] 72 2e-13 XP_017423029.1 PREDICTED: 40S ribosomal protein S15a [Vigna angu... 72 2e-13 JAT45703.1 40S ribosomal protein S15a, partial [Anthurium amnicola] 72 2e-13 ONK62321.1 uncharacterized protein A4U43_C07F2690 [Asparagus off... 72 4e-13 XP_002279090.1 PREDICTED: 40S ribosomal protein S15a [Vitis vini... 70 4e-13 KRY04072.1 40S ribosomal protein S15a [Trichinella patagoniensis] 70 4e-13 XP_012838678.1 PREDICTED: 40S ribosomal protein S15a [Erythranth... 70 4e-13 XP_015159926.1 PREDICTED: 40S ribosomal protein S15a-like isofor... 70 4e-13 JAT45546.1 40S ribosomal protein S15a [Anthurium amnicola] 70 6e-13 XP_014505890.1 PREDICTED: 40S ribosomal protein S15a [Vigna radi... 70 6e-13 XP_011625000.1 PREDICTED: 40S ribosomal protein S15a [Amborella ... 70 6e-13 XP_009403451.1 PREDICTED: 40S ribosomal protein S15a-like [Musa ... 70 6e-13 XP_008788086.1 PREDICTED: 40S ribosomal protein S15a [Phoenix da... 70 6e-13 XP_008776460.1 PREDICTED: 40S ribosomal protein S15a-like [Phoen... 70 6e-13 XP_007154598.1 hypothetical protein PHAVU_003G132300g [Phaseolus... 70 6e-13 XP_011073203.1 PREDICTED: 40S ribosomal protein S15a-like [Sesam... 70 8e-13 XP_010937690.1 PREDICTED: 40S ribosomal protein S15a [Elaeis gui... 70 8e-13 CBI31713.3 unnamed protein product, partial [Vitis vinifera] 70 1e-12 CDP09021.1 unnamed protein product [Coffea canephora] 69 1e-12 OMP05223.1 Ribosomal protein S8, partial [Corchorus capsularis] 67 1e-12 >JAT42634.1 40S ribosomal protein S15a [Anthurium amnicola] Length = 130 Score = 71.6 bits (174), Expect = 2e-13 Identities = 37/47 (78%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >XP_017423029.1 PREDICTED: 40S ribosomal protein S15a [Vigna angularis] XP_017423037.1 PREDICTED: 40S ribosomal protein S15a [Vigna angularis] XP_017429254.1 PREDICTED: 40S ribosomal protein S15a [Vigna angularis] KOM33595.1 hypothetical protein LR48_Vigan01g315100 [Vigna angularis] KOM47694.1 hypothetical protein LR48_Vigan07g139800 [Vigna angularis] BAT76863.1 hypothetical protein VIGAN_01492500 [Vigna angularis var. angularis] BAT77226.1 hypothetical protein VIGAN_01532300 [Vigna angularis var. angularis] ONK67789.1 uncharacterized protein A4U43_C05F3790 [Asparagus officinalis] ONK78473.1 uncharacterized protein A4U43_C02F19140 [Asparagus officinalis] Length = 130 Score = 71.6 bits (174), Expect = 2e-13 Identities = 37/47 (78%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >JAT45703.1 40S ribosomal protein S15a, partial [Anthurium amnicola] Length = 147 Score = 71.6 bits (174), Expect = 2e-13 Identities = 37/47 (78%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 67 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 113 >ONK62321.1 uncharacterized protein A4U43_C07F2690 [Asparagus officinalis] Length = 177 Score = 71.6 bits (174), Expect = 4e-13 Identities = 37/47 (78%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 97 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 143 >XP_002279090.1 PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] XP_002284061.1 PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] XP_010653512.1 PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] CAN65143.1 hypothetical protein VITISV_007037 [Vitis vinifera] CAN76515.1 hypothetical protein VITISV_017255 [Vitis vinifera] CBI32685.3 unnamed protein product, partial [Vitis vinifera] Length = 130 Score = 70.5 bits (171), Expect = 4e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHR+ KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >KRY04072.1 40S ribosomal protein S15a [Trichinella patagoniensis] Length = 130 Score = 70.5 bits (171), Expect = 4e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHR+ KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >XP_012838678.1 PREDICTED: 40S ribosomal protein S15a [Erythranthe guttata] XP_012852816.1 PREDICTED: 40S ribosomal protein S15a [Erythranthe guttata] XP_012827790.1 PREDICTED: 40S ribosomal protein S15a [Erythranthe guttata] EYU18937.1 hypothetical protein MIMGU_mgv1a016211mg [Erythranthe guttata] EYU24563.1 hypothetical protein MIMGU_mgv1a016215mg [Erythranthe guttata] EYU36257.1 hypothetical protein MIMGU_mgv1a016232mg [Erythranthe guttata] Length = 130 Score = 70.5 bits (171), Expect = 4e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHR+ KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >XP_015159926.1 PREDICTED: 40S ribosomal protein S15a-like isoform X1 [Solanum tuberosum] XP_015159927.1 PREDICTED: 40S ribosomal protein S15a-like isoform X2 [Solanum tuberosum] Length = 116 Score = 70.1 bits (170), Expect = 4e-13 Identities = 35/47 (74%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHR+ KIVVE N LNKCGVISPCFDV V +IE WT + LPS Sbjct: 36 FEYVDDHRSGKIVVELNGRLNKCGVISPCFDVGVKEIEGWTARLLPS 82 >JAT45546.1 40S ribosomal protein S15a [Anthurium amnicola] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KI VE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEYVDDHRAGKIAVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >XP_014505890.1 PREDICTED: 40S ribosomal protein S15a [Vigna radiata var. radiata] XP_014505891.1 PREDICTED: 40S ribosomal protein S15a [Vigna radiata var. radiata] XP_014505892.1 PREDICTED: 40S ribosomal protein S15a [Vigna radiata var. radiata] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FE+VDDHRA KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 50 FEFVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 96 >XP_011625000.1 PREDICTED: 40S ribosomal protein S15a [Amborella trichopoda] XP_011625001.1 PREDICTED: 40S ribosomal protein S15a [Amborella trichopoda] XP_011625002.1 PREDICTED: 40S ribosomal protein S15a [Amborella trichopoda] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEPWTARLLPS 96 >XP_009403451.1 PREDICTED: 40S ribosomal protein S15a-like [Musa acuminata subsp. malaccensis] XP_009409007.1 PREDICTED: 40S ribosomal protein S15a-like [Musa acuminata subsp. malaccensis] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEPWTARLLPS 96 >XP_008788086.1 PREDICTED: 40S ribosomal protein S15a [Phoenix dactylifera] XP_008792714.1 PREDICTED: 40S ribosomal protein S15a [Phoenix dactylifera] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEPWTARLLPS 96 >XP_008776460.1 PREDICTED: 40S ribosomal protein S15a-like [Phoenix dactylifera] XP_017696296.1 PREDICTED: 40S ribosomal protein S15a-like [Phoenix dactylifera] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEPWTARLLPS 96 >XP_007154598.1 hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] XP_009399987.1 PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] XP_009420087.1 PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] XP_010922386.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010905722.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_011089803.1 PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] ESW26592.1 hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] Length = 130 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEPWTARLLPS 96 >XP_011073203.1 PREDICTED: 40S ribosomal protein S15a-like [Sesamum indicum] XP_011089429.1 PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] XP_011089430.1 PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] XP_020101076.1 40S ribosomal protein S15a [Ananas comosus] XP_020114388.1 40S ribosomal protein S15a [Ananas comosus] OAY65957.1 40S ribosomal protein S15a [Ananas comosus] OAY83572.1 40S ribosomal protein S15a [Ananas comosus] Length = 130 Score = 69.7 bits (169), Expect = 8e-13 Identities = 35/47 (74%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FD+ V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEPWTARLLPS 96 >XP_010937690.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010937692.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010937693.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010937694.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] Length = 130 Score = 69.7 bits (169), Expect = 8e-13 Identities = 35/47 (74%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV + +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGIKEIEPWTARLLPS 96 >CBI31713.3 unnamed protein product, partial [Vitis vinifera] Length = 175 Score = 70.5 bits (171), Expect = 1e-12 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHR+ KIVVE N LNKCGVISP FDV V DIEPWT + LPS Sbjct: 95 FEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKDIEPWTARLLPS 141 >CDP09021.1 unnamed protein product [Coffea canephora] Length = 130 Score = 69.3 bits (168), Expect = 1e-12 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHRA KIVVE N LNKCGVISP FDV V +IEPWT + LPS Sbjct: 50 FEYVDDHRAGKIVVELNGRLNKCGVISPRFDVCVKEIEPWTARLLPS 96 >OMP05223.1 Ribosomal protein S8, partial [Corchorus capsularis] Length = 64 Score = 67.4 bits (163), Expect = 1e-12 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +2 Query: 26 FEYVDDHRARKIVVEPN*-LNKCGVISPCFDVEVMDIEPWTTKQLPS 163 FEYVDDHR KIVV+ N LNKCGVISPCFD+ V +IE WT + LPS Sbjct: 16 FEYVDDHRGGKIVVQLNGRLNKCGVISPCFDLGVKEIEVWTARLLPS 62