BLASTX nr result
ID: Alisma22_contig00019052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00019052 (557 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010934970.1 PREDICTED: scarecrow-like protein 27 [Elaeis guin... 59 9e-07 JAT58363.1 hypothetical protein g.74088, partial [Anthurium amni... 56 5e-06 >XP_010934970.1 PREDICTED: scarecrow-like protein 27 [Elaeis guineensis] Length = 781 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 12/63 (19%) Frame = +1 Query: 403 MRGMPFSLQGKGVVQLV--AEDLASGLWGSGG----------KKEASEPRSVLDHRRSRS 546 MRGMPFSLQ +G ++++ E+ S WGSGG + E SEPRSVLD+RRS S Sbjct: 1 MRGMPFSLQEEGALEVLIAGEEKKSLFWGSGGGCGNNKRRKGQPEGSEPRSVLDNRRSPS 60 Query: 547 PPT 555 PPT Sbjct: 61 PPT 63 >JAT58363.1 hypothetical protein g.74088, partial [Anthurium amnicola] Length = 479 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/72 (48%), Positives = 38/72 (52%), Gaps = 21/72 (29%) Frame = +1 Query: 403 MRGMPFSLQGKGVVQLVAEDLASGLW---------------------GSGGKKEASEPRS 519 MRGMPF+ QGKGVV+ A A LW G+ KKE EPRS Sbjct: 1 MRGMPFNHQGKGVVEAAAA--AEALWRTKNTACCGSTNNSSNSSSSFGARKKKEGVEPRS 58 Query: 520 VLDHRRSRSPPT 555 VLDHRRS SPPT Sbjct: 59 VLDHRRSPSPPT 70