BLASTX nr result
ID: Alisma22_contig00018628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00018628 (235 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP52605.1 Retrovirus-related Pol polyprotein from transposon TN... 74 1e-14 KYP51688.1 Retrovirus-related Pol polyprotein from transposon TN... 69 6e-13 XP_019153533.1 PREDICTED: uncharacterized protein LOC109150012 [... 72 7e-13 KYP32657.1 Retrovirus-related Pol polyprotein from transposon TN... 70 9e-13 KYP68424.1 Retrovirus-related Pol polyprotein from transposon TN... 69 2e-12 KYP49284.1 Retrovirus-related Pol polyprotein from transposon TN... 69 4e-12 KYP40190.1 Retrovirus-related Pol polyprotein from transposon TN... 69 5e-12 KYP45103.1 Retrovirus-related Pol polyprotein from transposon TN... 69 5e-12 CAN75900.1 hypothetical protein VITISV_033582 [Vitis vinifera] 69 5e-12 ABI34342.1 Polyprotein, putative [Solanum demissum] 69 5e-12 KYP76032.1 Retrovirus-related Pol polyprotein from transposon TN... 69 5e-12 KYP58728.1 Retrovirus-related Pol polyprotein from transposon TN... 69 5e-12 KYP40247.1 Retrovirus-related Pol polyprotein from transposon TN... 69 6e-12 KYP34729.1 Retrovirus-related Pol polyprotein from transposon TN... 69 7e-12 KYP74314.1 Retrovirus-related Pol polyprotein from transposon TN... 69 7e-12 XP_018716005.1 PREDICTED: uncharacterized protein LOC108954459 [... 69 9e-12 CAN80088.1 hypothetical protein VITISV_021656 [Vitis vinifera] 68 1e-11 ABI34329.1 Integrase core domain containing protein [Solanum dem... 68 1e-11 CAN63955.1 hypothetical protein VITISV_034255, partial [Vitis vi... 68 2e-11 XP_009778353.1 PREDICTED: uncharacterized protein LOC104227744 [... 68 2e-11 >KYP52605.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 160 Score = 73.6 bits (179), Expect = 1e-14 Identities = 28/55 (50%), Positives = 44/55 (80%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+CS + + SF++E Sbjct: 38 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNCSELFNIFQSFYSE 92 >KYP51688.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 160 Score = 68.9 bits (167), Expect = 6e-13 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 38 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 92 >XP_019153533.1 PREDICTED: uncharacterized protein LOC109150012 [Ipomoea nil] Length = 495 Score = 71.6 bits (174), Expect = 7e-13 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 F++V++D+ GPCS+ S GF+YF++F+DDFSR TWL+LLK CS + + F E Sbjct: 367 FELVHSDIWGPCSVTSKLGFKYFITFVDDFSRITWLYLLKSCSELFEVFCGFCVE 421 >KYP32657.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 217 Score = 69.7 bits (169), Expect = 9e-13 Identities = 26/55 (47%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+C + + SF+++ Sbjct: 38 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNCYELFNIFLSFYSK 92 >KYP68424.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 245 Score = 68.9 bits (167), Expect = 2e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 38 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 92 >KYP49284.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 284 Score = 68.9 bits (167), Expect = 4e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 38 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 92 >KYP40190.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 478 Score = 69.3 bits (168), Expect = 5e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 38 FDVIHSDVWGPSRIPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 92 >KYP45103.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 326 Score = 68.9 bits (167), Expect = 5e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 244 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFQSFYSE 298 >CAN75900.1 hypothetical protein VITISV_033582 [Vitis vinifera] Length = 1041 Score = 69.3 bits (168), Expect = 5e-12 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = -1 Query: 175 KQTFDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 K F++VY DV GPC S GF+YF++FIDD+SR TWLFL+K+ + + F+AE Sbjct: 221 KSPFELVYTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIFQKFYAE 278 >ABI34342.1 Polyprotein, putative [Solanum demissum] Length = 1054 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 F +V++D+ GP + S GFRYF+SFIDD+SR TW+FL+KD S + SFFAE Sbjct: 301 FSLVHSDIWGPSRVSSTLGFRYFVSFIDDYSRCTWVFLMKDRSELFSIFKSFFAE 355 >KYP76032.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1355 Score = 69.3 bits (168), Expect = 5e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 476 FDVIHSDVWGPSRIPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 530 >KYP58728.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1402 Score = 69.3 bits (168), Expect = 5e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 523 FDVIHSDVWGPSRIPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 577 >KYP40247.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 385 Score = 68.9 bits (167), Expect = 6e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 244 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFQSFYSE 298 >KYP34729.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1180 Score = 68.9 bits (167), Expect = 7e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 318 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 372 >KYP74314.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1275 Score = 68.9 bits (167), Expect = 7e-12 Identities = 27/55 (49%), Positives = 43/55 (78%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 FD++++DV GP +PS+ G RY+++FIDDFSR TW+FL+K+ S + + SF++E Sbjct: 523 FDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLMKNRSELFNIFLSFYSE 577 >XP_018716005.1 PREDICTED: uncharacterized protein LOC108954459 [Eucalyptus grandis] Length = 878 Score = 68.6 bits (166), Expect = 9e-12 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 F++V++DV GPC + +F F+YF+ F+DDFSR TWLFL+KDC+ + F+ E Sbjct: 647 FELVHSDVWGPCRVSDVFRFKYFVIFVDDFSRMTWLFLIKDCTEIFRCFQLFYFE 701 >CAN80088.1 hypothetical protein VITISV_021656 [Vitis vinifera] Length = 1099 Score = 68.2 bits (165), Expect = 1e-11 Identities = 28/58 (48%), Positives = 41/58 (70%) Frame = -1 Query: 175 KQTFDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 K F++V+ DV GPC + S GF+YF++FIDD+SR TWLFL+K+ + + F+AE Sbjct: 412 KSPFELVHIDVWGPCRIASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIFQKFYAE 469 >ABI34329.1 Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 68.2 bits (165), Expect = 1e-11 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -1 Query: 166 FDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 F +V++D+ GP + S GFRYF+SFIDD+S+ TW+FL+KD S + SFFAE Sbjct: 540 FSLVHSDIWGPSRVSSTLGFRYFVSFIDDYSKCTWVFLMKDRSELFSIFKSFFAE 594 >CAN63955.1 hypothetical protein VITISV_034255, partial [Vitis vinifera] Length = 1117 Score = 67.8 bits (164), Expect = 2e-11 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = -1 Query: 190 KCIG--FKQTFDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTIT 17 KC+ K F++V+ DV GPC S GF+YF++FIDD+SR TWLFL+K+ + + Sbjct: 447 KCLNNWAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIFQ 506 Query: 16 SFFAE 2 F+AE Sbjct: 507 KFYAE 511 >XP_009778353.1 PREDICTED: uncharacterized protein LOC104227744 [Nicotiana sylvestris] Length = 1133 Score = 67.8 bits (164), Expect = 2e-11 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -1 Query: 175 KQTFDIVYADV*GPCSLPSIFGFRYFMSFIDDFSRTTWLFLLKDCSHMLDTITSFFAE 2 + F +V++D+ GP + S GFRYF+SFIDD+SR TWLFL+KD S + SF AE Sbjct: 683 ESVFSLVHSDIWGPSRVSSTLGFRYFVSFIDDYSRCTWLFLMKDRSELFSIFQSFCAE 740