BLASTX nr result
ID: Alisma22_contig00018595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00018595 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ67706.1 Synaptonemal complex protein [Zostera marina] 54 2e-06 >KMZ67706.1 Synaptonemal complex protein [Zostera marina] Length = 879 Score = 53.9 bits (128), Expect = 2e-06 Identities = 34/76 (44%), Positives = 42/76 (55%), Gaps = 2/76 (2%) Frame = -3 Query: 265 QQDNLEVXXXXXXXXXXXKND-NQRRKEILLNAPEKQKKDIDISQILRTPVANMLLKVEK 89 QQ+NLEV + D N K N PEK+KK+IDIS+I+R PVANML K E+ Sbjct: 721 QQNNLEVNSKKEYSFSSARRDANNNGKGSQFNRPEKRKKEIDISEIMRIPVANMLRKTER 780 Query: 88 ENN-GNCAITRRQRRK 44 N N + RRK Sbjct: 781 RGNPENVISVPKPRRK 796