BLASTX nr result
ID: Alisma22_contig00018314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00018314 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACF82744.1 unknown [Zea mays] 68 2e-13 KHN24044.1 Putative pre-mRNA-splicing factor ATP-dependent RNA h... 72 7e-13 XP_003553003.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 72 7e-13 KDO71106.1 hypothetical protein CISIN_1g0010461mg, partial [Citr... 68 9e-13 EEE56791.1 hypothetical protein OsJ_06373 [Oryza sativa Japonica... 68 9e-13 AFK37844.1 unknown [Medicago truncatula] 67 1e-12 CDY51663.1 BnaC03g67020D [Brassica napus] 65 1e-12 XP_007212060.1 hypothetical protein PRUPE_ppa011497mg [Prunus pe... 68 4e-12 XP_006395547.1 hypothetical protein EUTSA_v100035630mg, partial ... 68 6e-12 XP_006451105.1 hypothetical protein CICLE_v10007378mg [Citrus cl... 69 6e-12 BAD94695.1 ATP-dependent RNA helicase [Arabidopsis thaliana] 68 8e-12 XP_002876982.1 hypothetical protein ARALYDRAFT_347015 [Arabidops... 68 8e-12 CDX91491.1 BnaC04g06590D [Brassica napus] 63 1e-11 XP_019187957.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 XP_019187956.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 XP_019173426.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 XP_010536075.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 XP_016552731.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 XP_019182334.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 XP_008808919.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 68 1e-11 >ACF82744.1 unknown [Zea mays] Length = 63 Score = 67.8 bits (164), Expect = 2e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 30 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 63 >KHN24044.1 Putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Glycine soja] Length = 887 Score = 71.6 bits (174), Expect = 7e-13 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQEC+EPL+DRYHEP+SWRLSKRRA Sbjct: 854 DPTKMSKRKRQECLEPLYDRYHEPNSWRLSKRRA 887 >XP_003553003.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase [Glycine max] KRG97373.1 hypothetical protein GLYMA_18G004000 [Glycine max] Length = 945 Score = 71.6 bits (174), Expect = 7e-13 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQEC+EPL+DRYHEP+SWRLSKRRA Sbjct: 912 DPTKMSKRKRQECLEPLYDRYHEPNSWRLSKRRA 945 >KDO71106.1 hypothetical protein CISIN_1g0010461mg, partial [Citrus sinensis] Length = 130 Score = 67.8 bits (164), Expect = 9e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 97 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 130 >EEE56791.1 hypothetical protein OsJ_06373 [Oryza sativa Japonica Group] Length = 133 Score = 67.8 bits (164), Expect = 9e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 100 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 133 >AFK37844.1 unknown [Medicago truncatula] Length = 133 Score = 67.4 bits (163), Expect = 1e-12 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE +EPL+DRYHEP+SWRLSKRRA Sbjct: 100 DPTKMSKRKRQERVEPLYDRYHEPNSWRLSKRRA 133 >CDY51663.1 BnaC03g67020D [Brassica napus] Length = 63 Score = 65.5 bits (158), Expect = 1e-12 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPT +SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 30 DPTHMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 63 >XP_007212060.1 hypothetical protein PRUPE_ppa011497mg [Prunus persica] ONI21638.1 hypothetical protein PRUPE_2G077500 [Prunus persica] Length = 208 Score = 67.8 bits (164), Expect = 4e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 175 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 208 >XP_006395547.1 hypothetical protein EUTSA_v100035630mg, partial [Eutrema salsugineum] ESQ32833.1 hypothetical protein EUTSA_v100035630mg, partial [Eutrema salsugineum] Length = 236 Score = 67.8 bits (164), Expect = 6e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 203 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 236 >XP_006451105.1 hypothetical protein CICLE_v10007378mg [Citrus clementina] XP_006475709.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Citrus sinensis] ESR64345.1 hypothetical protein CICLE_v10007378mg [Citrus clementina] Length = 942 Score = 68.9 bits (167), Expect = 6e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTKISKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 909 DPTKISKRKRQERIEPLYDRYHEPNSWRLSKRRA 942 >BAD94695.1 ATP-dependent RNA helicase [Arabidopsis thaliana] Length = 273 Score = 67.8 bits (164), Expect = 8e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 240 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 273 >XP_002876982.1 hypothetical protein ARALYDRAFT_347015 [Arabidopsis lyrata subsp. lyrata] EFH53241.1 hypothetical protein ARALYDRAFT_347015 [Arabidopsis lyrata subsp. lyrata] Length = 275 Score = 67.8 bits (164), Expect = 8e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 242 DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 275 >CDX91491.1 BnaC04g06590D [Brassica napus] Length = 63 Score = 63.2 bits (152), Expect = 1e-11 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 7 PTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 PT +SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 31 PTHMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 63 >XP_019187957.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 isoform X2 [Ipomoea nil] Length = 946 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 913 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 946 >XP_019187956.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 isoform X1 [Ipomoea nil] Length = 1142 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 1109 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1142 >XP_019173426.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Ipomoea nil] Length = 1165 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 1132 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1165 >XP_010536075.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Tarenaya hassleriana] Length = 1178 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 1145 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1178 >XP_016552731.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Capsicum annuum] Length = 1182 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 1149 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1182 >XP_019182334.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Ipomoea nil] XP_019182335.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Ipomoea nil] Length = 1183 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 1150 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1183 >XP_008808919.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 [Phoenix dactylifera] Length = 1184 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 DPTKISKRKRQECIEPLFDRYHEPHSWRLSKRRA 105 DPTK+SKRKRQE IEPL+DRYHEP+SWRLSKRRA Sbjct: 1151 DPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1184