BLASTX nr result
ID: Alisma22_contig00018283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00018283 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB76580.1 hypothetical protein B456_012G099700 [Gossypium raimo... 52 4e-06 ERN11126.1 hypothetical protein AMTR_s00024p00170520 [Amborella ... 52 5e-06 NP_001330198.1 WCRKC thioredoxin 1 [Arabidopsis thaliana] ANM684... 52 5e-06 NP_001031844.1 WCRKC thioredoxin 1 [Arabidopsis thaliana] AED910... 52 5e-06 >KJB76580.1 hypothetical protein B456_012G099700 [Gossypium raimondii] Length = 163 Score = 51.6 bits (122), Expect = 4e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 259 RIKFYYVDVNSVPQALVKRGNISVC 185 +IKFYYVDVN VPQALVKRGNISVC Sbjct: 128 KIKFYYVDVNKVPQALVKRGNISVC 152 >ERN11126.1 hypothetical protein AMTR_s00024p00170520 [Amborella trichopoda] Length = 174 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 259 RIKFYYVDVNSVPQALVKRGNISVC 185 RIKFY+VDVN+VPQALVKRGNISVC Sbjct: 136 RIKFYFVDVNNVPQALVKRGNISVC 160 >NP_001330198.1 WCRKC thioredoxin 1 [Arabidopsis thaliana] ANM68441.1 WCRKC thioredoxin 1 [Arabidopsis thaliana] Length = 213 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/34 (73%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = -1 Query: 259 RIKFYYVDVNSVPQALVKRGNISV-CLSSIISYY 161 R KFYYVDVN VPQ LVKRGNISV CL+ I+S++ Sbjct: 150 RAKFYYVDVNKVPQTLVKRGNISVKCLNIILSFF 183 >NP_001031844.1 WCRKC thioredoxin 1 [Arabidopsis thaliana] AED91051.1 WCRKC thioredoxin 1 [Arabidopsis thaliana] Length = 214 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/34 (73%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = -1 Query: 259 RIKFYYVDVNSVPQALVKRGNISV-CLSSIISYY 161 R KFYYVDVN VPQ LVKRGNISV CL+ I+S++ Sbjct: 150 RAKFYYVDVNKVPQTLVKRGNISVKCLNIILSFF 183