BLASTX nr result
ID: Alisma22_contig00017594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00017594 (668 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010912918.2 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-06 XP_008808163.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-06 XP_008808162.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-06 >XP_010912918.2 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Elaeis guineensis] Length = 779 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/61 (50%), Positives = 38/61 (62%) Frame = +3 Query: 483 PIRDFLRSRSPAADPVVEGRVAFQKNRRSSWHLAADFSSKNLSNSYEEDDDPEAESVSGS 662 PI +F +SRS DP EGR+ Q+NRRSSWH+ ADF S +L EE+D E S S Sbjct: 159 PILNFFKSRSETQDPKREGRLTLQRNRRSSWHI-ADFESDDLEEEEEEEDVQAVELDSDS 217 Query: 663 G 665 G Sbjct: 218 G 218 >XP_008808163.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Phoenix dactylifera] Length = 744 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = +3 Query: 483 PIRDFLRSRSPAADPVVEGRVAFQKNRRSSWHLAADFSSKNLSNSYEEDDDPEAESV 653 PIR+F +SRS DP EGR+ Q+NRRS+WH+ AD S ++ EE+++ E ++V Sbjct: 121 PIRNFFKSRSETRDPKREGRLTLQRNRRSTWHI-ADLQSDDIEEEEEEEEEEEVQAV 176 >XP_008808162.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Phoenix dactylifera] Length = 756 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = +3 Query: 483 PIRDFLRSRSPAADPVVEGRVAFQKNRRSSWHLAADFSSKNLSNSYEEDDDPEAESV 653 PIR+F +SRS DP EGR+ Q+NRRS+WH+ AD S ++ EE+++ E ++V Sbjct: 121 PIRNFFKSRSETRDPKREGRLTLQRNRRSTWHI-ADLQSDDIEEEEEEEEEEEVQAV 176