BLASTX nr result
ID: Alisma22_contig00017460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00017460 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV73821.1 hypothetical protein CFOL_v3_17304, partial [Cephalot... 55 3e-07 >GAV73821.1 hypothetical protein CFOL_v3_17304, partial [Cephalotus follicularis] Length = 166 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = -3 Query: 319 GRGTSQG---PRHCNWCGRDNHTEDRCWIKHGKPAWANQTADDAAVADSPAEISPAPT 155 GRG+S G P C++CG++ HT D CW KHGKP W +TA+ A + +S T Sbjct: 108 GRGSSFGGKPPMKCSYCGKNGHTIDYCWDKHGKPDWVPKTANHAMLDGDHDSVSSGDT 165