BLASTX nr result
ID: Alisma22_contig00016773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00016773 (326 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT50383.1 Pentatricopeptide repeat-containing protein At5g66520... 62 8e-09 >JAT50383.1 Pentatricopeptide repeat-containing protein At5g66520 [Anthurium amnicola] Length = 632 Score = 61.6 bits (148), Expect = 8e-09 Identities = 35/66 (53%), Positives = 41/66 (62%) Frame = +3 Query: 111 HIHQVHGQLILLGHATSXXXXXXXXXXXXXSTSFVPPLSYTCAVFHRIYLPNVFAYNNFI 290 H+HQVH QL+LLG A+S S S P +Y+ AVF +I LPNVFA NNFI Sbjct: 41 HLHQVHAQLVLLGLASSRAAMGHLLAACAVSPSASP--AYSRAVFLQIDLPNVFACNNFI 98 Query: 291 RCLVRA 308 RCL RA Sbjct: 99 RCLARA 104